CsaV3_5G013330 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CTATTATTCTTCAACAAATACATTCAAACCCAAATTCACATTCCTCAACTTCAATCAAAAAACAATGGCTGATATTTGTCCTCCTGGTATTGTTTCCATTTATGATTTTACATTACAACAAGTTTTAAAACACTCTATATACATTTTATACAGTGTTCGTGAGCTTTCTAATTCAACGTTCGCAATTGGGGTTAGATTTTTTGTAATCGAATACCCATTTGAAGCATTAAGAAAAAATATGAAGTTATTGTCTCTCAAAACCGATTTGGAACGAGTGGAACAACATTTATGTCTTTGATTACTGCTATGAAGATTTATTTGTACCACTTATTTCCTTTTTGGCTTCTTCATGATTATGGAATACTTCTGTTTGATGATCTTTAGGCTGTAGTTTTGTTTGAATATTTTTCCATTATATCTCTTCGGATATTTCATATTGTGATGATTAAATTTGGTTATTTGTTTTGGTATATAATTATGATCAGGAAAAAATCAGTGGCCAGAACTTGTTGGAGTAAAAGCAACAACTGCAAAGTATATCATCAAGAAGGACAACCCTAACGTAGAAAATGTTGTAGTTCTCTTGGCTGGAAGTGGAACCACGGAAGATATTAGGTGTGATCGAGTTTGGGTGTTCGTTAATATACACGACCTGGTTGTTGAAGTTCCAAAGGTTGGTTAA ATGGCTGATATTTGTCCTCCTGGAAAAAATCAGTGGCCAGAACTTGTTGGAGTAAAAGCAACAACTGCAAAGTATATCATCAAGAAGGACAACCCTAACGTAGAAAATGTTGTAGTTCTCTTGGCTGGAAGTGGAACCACGGAAGATATTAGGTGTGATCGAGTTTGGGTGTTCGTTAATATACACGACCTGGTTGTTGAAGTTCCAAAGGTTGGTTAA ATGGCTGATATTTGTCCTCCTGGAAAAAATCAGTGGCCAGAACTTGTTGGAGTAAAAGCAACAACTGCAAAGTATATCATCAAGAAGGACAACCCTAACGTAGAAAATGTTGTAGTTCTCTTGGCTGGAAGTGGAACCACGGAAGATATTAGGTGTGATCGAGTTTGGGTGTTCGTTAATATACACGACCTGGTTGTTGAAGTTCCAAAGGTTGGTTAA MADICPPGKNQWPELVGVKATTAKYIIKKDNPNVENVVVLLAGSGTTEDIRCDRVWVFVNIHDLVVEVPKVG* Homology
BLAST of CsaV3_5G013330 vs. NCBI nr
Match: KGN50840.1 (hypothetical protein Csa_004718 [Cucumis sativus]) HSP 1 Score: 155.6 bits (392), Expect = 1.6e-34 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. NCBI nr
Match: ALD47589.1 (serine proteinase inhibitor [Cucumis metulifer]) HSP 1 Score: 136.7 bits (343), Expect = 7.8e-29 Identity = 59/72 (81.94%), Postives = 69/72 (95.83%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. NCBI nr
Match: KGN50838.1 (hypothetical protein Csa_004692 [Cucumis sativus]) HSP 1 Score: 121.7 bits (304), Expect = 2.6e-24 Identity = 55/72 (76.39%), Postives = 62/72 (86.11%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. NCBI nr
Match: KAG6571494.1 (hypothetical protein SDJN03_28222, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 112.1 bits (279), Expect = 2.1e-21 Identity = 46/72 (63.89%), Postives = 61/72 (84.72%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. NCBI nr
Match: KAG6571499.1 (Proteinase inhibitor I-B, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 90.9 bits (224), Expect = 4.9e-15 Identity = 41/72 (56.94%), Postives = 51/72 (70.83%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. ExPASy Swiss-Prot
Match: P20076 (Ethylene-responsive proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 3.9e-15 Identity = 37/64 (57.81%), Postives = 47/64 (73.44%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. ExPASy Swiss-Prot
Match: P16231 (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.5e-14 Identity = 36/64 (56.25%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. ExPASy Swiss-Prot
Match: Q02214 (Trypsin inhibitor 1 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.3e-13 Identity = 35/69 (50.72%), Postives = 49/69 (71.01%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. ExPASy Swiss-Prot
Match: Q03199 (Proteinase inhibitor I-B OS=Nicotiana tabacum OX=4097 GN=TIMPA PE=2 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.8e-13 Identity = 33/64 (51.56%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. ExPASy Swiss-Prot
Match: Q03198 (Proteinase inhibitor I-A OS=Nicotiana tabacum OX=4097 GN=TIMPB PE=2 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 4.8e-13 Identity = 31/64 (48.44%), Postives = 45/64 (70.31%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. ExPASy TrEMBL
Match: A0A0A0KME7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G286040 PE=3 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 7.9e-35 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. ExPASy TrEMBL
Match: A0A0M3SAG8 (Serine proteinase inhibitor OS=Cucumis metulifer OX=61886 PE=2 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 3.8e-29 Identity = 59/72 (81.94%), Postives = 69/72 (95.83%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. ExPASy TrEMBL
Match: A0A0A0KMM0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G285030 PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 1.3e-24 Identity = 55/72 (76.39%), Postives = 62/72 (86.11%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. ExPASy TrEMBL
Match: A0A6J1HFK9 (inhibitor of trypsin and hageman factor-like OS=Cucurbita moschata OX=3662 GN=LOC111463862 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 3.5e-14 Identity = 39/74 (52.70%), Postives = 54/74 (72.97%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. ExPASy TrEMBL
Match: A0A4Y7LG33 (Uncharacterized protein OS=Papaver somniferum OX=3469 GN=C5167_046386 PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 4.5e-14 Identity = 42/72 (58.33%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 68.9 bits (167), Expect = 1.9e-12 Identity = 33/66 (50.00%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 67.8 bits (164), Expect = 4.2e-12 Identity = 32/73 (43.84%), Postives = 49/73 (67.12%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TAIR 10
Match: AT2G38900.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 55.5 bits (132), Expect = 2.1e-08 Identity = 29/65 (44.62%), Postives = 40/65 (61.54%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TAIR 10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 55.5 bits (132), Expect = 2.1e-08 Identity = 29/65 (44.62%), Postives = 40/65 (61.54%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TAIR 10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 53.9 bits (128), Expect = 6.2e-08 Identity = 27/71 (38.03%), Postives = 41/71 (57.75%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|