![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CsaV3_4G029110 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TCCTTGAGGTTGGAGATGGTGTATTTGAGGTTCTTTCTACTTCAGGCGATACACATTTGGGTGGCAATGATTTTGACAAGGTTGAGTCACTCATTTTTCCTATAACTTCCATGTGTTTCTTTATTTGCAGAAAATGACATTTCTGCTTTATTACTTTCAGAGAATTGTCGGTTGGCTTGCTGAGAGCTTTAAGAGGGATGAAGGAGTAAACCTTTTGAAAGACAAACAGGCGCTGCAACGTCTAACCTAA CTTGAGGTTGGAGATGGTGTATTTGAGGTTCTTTCTACTTCAGGCGATACACATTTGGGTGGCAATGATTTTGACAAGAGAATTGTCGGTTGGCTTGCTGAGAGCTTTAAGAGGGATGAAGGAGTAAACCTTTTGAAAGACAAACAGGCGCTGCAACGTCTAACCTA CTTGAGGTTGGAGATGGTGTATTTGAGGTTCTTTCTACTTCAGGCGATACACATTTGGGTGGCAATGATTTTGACAAGAGAATTGTCGGTTGGCTTGCTGAGAGCTTTAAGAGGGATGAAGGAGTAAACCTTTTGAAAGACAAACAGGCGCTGCAACGTCTAACCTA LEVGDGVFEVLSTSGDTHLGGNDFDKRIVGWLAESFKRDEGVNLLKDKQALQRLTX Homology
BLAST of CsaV3_4G029110 vs. NCBI nr
Match: KAE8649657.1 (hypothetical protein Csa_023754, partial [Cucumis sativus]) HSP 1 Score: 114.8 bits (286), Expect = 2.4e-22 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. NCBI nr
Match: PWA47516.1 (chaperone protein dnaK2 [Artemisia annua]) HSP 1 Score: 107.8 bits (268), Expect = 3.0e-20 Identity = 51/55 (92.73%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. NCBI nr
Match: PWA47517.1 (chaperone protein dnaK2 [Artemisia annua]) HSP 1 Score: 107.8 bits (268), Expect = 3.0e-20 Identity = 51/55 (92.73%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. NCBI nr
Match: KAA0038168.1 (stromal 70 kDa heat shock-related protein [Cucumis melo var. makuwa] >TYK31527.1 stromal 70 kDa heat shock-related protein [Cucumis melo var. makuwa]) HSP 1 Score: 107.8 bits (268), Expect = 3.0e-20 Identity = 51/55 (92.73%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. NCBI nr
Match: XP_038897254.1 (stromal 70 kDa heat shock-related protein, chloroplastic-like [Benincasa hispida]) HSP 1 Score: 107.8 bits (268), Expect = 3.0e-20 Identity = 51/55 (92.73%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. ExPASy Swiss-Prot
Match: Q08080 (Stromal 70 kDa heat shock-related protein, chloroplastic (Fragment) OS=Spinacia oleracea OX=3562 GN=CHSP70 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 1.5e-22 Identity = 50/55 (90.91%), Postives = 53/55 (96.36%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. ExPASy Swiss-Prot
Match: Q9LTX9 (Heat shock 70 kDa protein 7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HSP70-7 PE=2 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 9.7e-22 Identity = 47/55 (85.45%), Postives = 53/55 (96.36%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. ExPASy Swiss-Prot
Match: Q02028 (Stromal 70 kDa heat shock-related protein, chloroplastic OS=Pisum sativum OX=3888 GN=HSP70 PE=2 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 9.7e-22 Identity = 48/55 (87.27%), Postives = 52/55 (94.55%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. ExPASy Swiss-Prot
Match: Q9STW6 (Heat shock 70 kDa protein 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HSP70-6 PE=1 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 1.6e-21 Identity = 47/55 (85.45%), Postives = 52/55 (94.55%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. ExPASy Swiss-Prot
Match: Q8YW74 (Chaperone protein dnaK2 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=dnaK2 PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.0e-19 Identity = 44/55 (80.00%), Postives = 52/55 (94.55%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. ExPASy TrEMBL
Match: A0A5D3E5W9 (Stromal 70 kDa heat shock-related protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold172G00050 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.4e-20 Identity = 51/55 (92.73%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. ExPASy TrEMBL
Match: A0A7N0ZU01 (Uncharacterized protein OS=Kalanchoe fedtschenkoi OX=63787 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.4e-20 Identity = 51/55 (92.73%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. ExPASy TrEMBL
Match: A0A2U1LET4 (Chaperone protein dnaK2 OS=Artemisia annua OX=35608 GN=CTI12_AA498570 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.4e-20 Identity = 51/55 (92.73%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. ExPASy TrEMBL
Match: A0A2U1LEU5 (Chaperone protein dnaK2 OS=Artemisia annua OX=35608 GN=CTI12_AA498570 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.4e-20 Identity = 51/55 (92.73%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. ExPASy TrEMBL
Match: A0A5N6N5S0 (Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_25460 PE=3 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 1.4e-20 Identity = 51/55 (92.73%), Postives = 54/55 (98.18%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. TAIR 10
Match: AT5G49910.1 (chloroplast heat shock protein 70-2 ) HSP 1 Score: 103.2 bits (256), Expect = 6.9e-23 Identity = 47/55 (85.45%), Postives = 53/55 (96.36%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. TAIR 10
Match: AT4G24280.1 (chloroplast heat shock protein 70-1 ) HSP 1 Score: 102.4 bits (254), Expect = 1.2e-22 Identity = 47/55 (85.45%), Postives = 52/55 (94.55%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. TAIR 10
Match: AT5G09590.1 (mitochondrial HSO70 2 ) HSP 1 Score: 67.0 bits (162), Expect = 5.5e-12 Identity = 30/54 (55.56%), Postives = 40/54 (74.07%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. TAIR 10
Match: AT4G37910.1 (mitochondrial heat shock protein 70-1 ) HSP 1 Score: 65.1 bits (157), Expect = 2.1e-11 Identity = 29/54 (53.70%), Postives = 38/54 (70.37%), Query Frame = 0
BLAST of CsaV3_4G029110 vs. TAIR 10
Match: AT1G09080.1 (Heat shock protein 70 (Hsp 70) family protein ) HSP 1 Score: 59.3 bits (142), Expect = 1.1e-09 Identity = 27/54 (50.00%), Postives = 38/54 (70.37%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|