CsaV3_2G030800 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATCTACGAGGTGAAGCAGCAGAGACTTTGTATTTTGAAGCAAAATGTAGAATTGAAGATCCAATTTACGGATGTGTTGGGATTATTTCCCAATTACAATATGAATTACACGTGGCAGAAACCCAGTTGGCCAAAACTCGAGCTGAGATTGCTCTCCTCGCTTCCAACCGTCAACAAGCCCAACACGAAGACTTTCCATTTGATGACCCCAGCTCAGGCCCAATTTTTACTGGGCTTTCCACTCCAGCCCACTTTTCTGAGCAATTGTTTCGTGCTTAG ATGGATCTACGAGGTGAAGCAGCAGAGACTTTGTATTTTGAAGCAAAATGTAGAATTGAAGATCCAATTTACGGATGTGTTGGGATTATTTCCCAATTACAATATGAATTACACGTGGCAGAAACCCAGTTGGCCAAAACTCGAGCTGAGATTGCTCTCCTCGCTTCCAACCGTCAACAAGCCCAACACGAAGACTTTCCATTTGATGACCCCAGCTCAGGCCCAATTTTTACTGGGCTTTCCACTCCAGCCCACTTTTCTGAGCAATTGTTTCGTGCTTAG ATGGATCTACGAGGTGAAGCAGCAGAGACTTTGTATTTTGAAGCAAAATGTAGAATTGAAGATCCAATTTACGGATGTGTTGGGATTATTTCCCAATTACAATATGAATTACACGTGGCAGAAACCCAGTTGGCCAAAACTCGAGCTGAGATTGCTCTCCTCGCTTCCAACCGTCAACAAGCCCAACACGAAGACTTTCCATTTGATGACCCCAGCTCAGGCCCAATTTTTACTGGGCTTTCCACTCCAGCCCACTTTTCTGAGCAATTGTTTCGTGCTTAG MDLRGEAAETLYFEAKCRIEDPIYGCVGIISQLQYELHVAETQLAKTRAEIALLASNRQQAQHEDFPFDDPSSGPIFTGLSTPAHFSEQLFRA* Homology
BLAST of CsaV3_2G030800 vs. NCBI nr
Match: KAE8652162.1 (hypothetical protein Csa_022646 [Cucumis sativus]) HSP 1 Score: 193.0 bits (489), Expect = 1.2e-45 Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. NCBI nr
Match: XP_023522202.1 (LOB domain-containing protein 24-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 122.9 bits (307), Expect = 1.5e-24 Identity = 64/90 (71.11%), Postives = 74/90 (82.22%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. NCBI nr
Match: XP_022923144.1 (LOB domain-containing protein 24-like [Cucurbita moschata]) HSP 1 Score: 120.6 bits (301), Expect = 7.5e-24 Identity = 63/90 (70.00%), Postives = 73/90 (81.11%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. NCBI nr
Match: KAG7014789.1 (LOB domain-containing protein 24, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 119.8 bits (299), Expect = 1.3e-23 Identity = 63/88 (71.59%), Postives = 72/88 (81.82%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. NCBI nr
Match: XP_022985104.1 (LOB domain-containing protein 24-like [Cucurbita maxima]) HSP 1 Score: 119.4 bits (298), Expect = 1.7e-23 Identity = 64/89 (71.91%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. ExPASy Swiss-Prot
Match: P59468 (LOB domain-containing protein 24 OS=Arabidopsis thaliana OX=3702 GN=LBD24 PE=2 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.7e-13 Identity = 33/63 (52.38%), Postives = 46/63 (73.02%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. ExPASy Swiss-Prot
Match: P59467 (LOB domain-containing protein 23 OS=Arabidopsis thaliana OX=3702 GN=LBD23 PE=1 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 5.2e-12 Identity = 32/63 (50.79%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. ExPASy Swiss-Prot
Match: Q9SHE9 (LOB domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=LBD4 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 6.0e-08 Identity = 31/75 (41.33%), Postives = 44/75 (58.67%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. ExPASy Swiss-Prot
Match: Q9SA51 (LOB domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=LBD3 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.9e-07 Identity = 23/48 (47.92%), Postives = 34/48 (70.83%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. ExPASy Swiss-Prot
Match: Q8LBW3 (LOB domain-containing protein 12 OS=Arabidopsis thaliana OX=3702 GN=LBD12 PE=1 SV=2) HSP 1 Score: 55.1 bits (131), Expect = 5.1e-07 Identity = 27/69 (39.13%), Postives = 39/69 (56.52%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. ExPASy TrEMBL
Match: A0A0A0LLX6 (LOB domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_2G373510 PE=3 SV=1) HSP 1 Score: 193.0 bits (489), Expect = 5.8e-46 Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. ExPASy TrEMBL
Match: A0A6J1E5I6 (LOB domain-containing protein 24-like OS=Cucurbita moschata OX=3662 GN=LOC111430896 PE=3 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 3.6e-24 Identity = 63/90 (70.00%), Postives = 73/90 (81.11%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. ExPASy TrEMBL
Match: A0A6J1JCD0 (LOB domain-containing protein 24-like OS=Cucurbita maxima OX=3661 GN=LOC111483182 PE=3 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 8.1e-24 Identity = 64/89 (71.91%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. ExPASy TrEMBL
Match: A0A0A0L9N7 (LOB domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G180300 PE=3 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 8.1e-24 Identity = 65/95 (68.42%), Postives = 72/95 (75.79%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. ExPASy TrEMBL
Match: A0A1S3AY36 (LOB domain-containing protein 24-like OS=Cucumis melo OX=3656 GN=LOC103484045 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 4.0e-23 Identity = 65/97 (67.01%), Postives = 73/97 (75.26%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. TAIR 10
Match: AT3G26660.1 (LOB domain-containing protein 24 ) HSP 1 Score: 75.1 bits (183), Expect = 3.4e-14 Identity = 33/63 (52.38%), Postives = 46/63 (73.02%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. TAIR 10
Match: AT3G26620.1 (LOB domain-containing protein 23 ) HSP 1 Score: 71.6 bits (174), Expect = 3.7e-13 Identity = 32/63 (50.79%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. TAIR 10
Match: AT1G31320.1 (LOB domain-containing protein 4 ) HSP 1 Score: 58.2 bits (139), Expect = 4.3e-09 Identity = 31/75 (41.33%), Postives = 44/75 (58.67%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. TAIR 10
Match: AT1G16530.1 (ASYMMETRIC LEAVES 2-like 9 ) HSP 1 Score: 55.5 bits (132), Expect = 2.8e-08 Identity = 23/48 (47.92%), Postives = 34/48 (70.83%), Query Frame = 0
BLAST of CsaV3_2G030800 vs. TAIR 10
Match: AT2G30130.1 (Lateral organ boundaries (LOB) domain family protein ) HSP 1 Score: 55.1 bits (131), Expect = 3.6e-08 Identity = 27/69 (39.13%), Postives = 39/69 (56.52%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|