CsaV3_1G043550 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTACAACAAACTTCATAGTGATGCGTTGAGAGAAGCCATTTCATCTATATTTGCTGATAGCGGTGAAAAGAAGCGCAAATTCACCGAGACCATTGAACTTCATATTGGACTGAAGAACTATGATCCACAAAAGGACAAGCGTTTCAGTGGTTCAGTGAAGTTGCCGCATATCCCTCGCCCTAAGATGAAGATCTGCATTCTTGGAGATGTTTCACATGTTGAAGAGGTAACTTAATCTCCTCTTTTACATCTTCACTTAATCACTTGTTATGCTCAGTTACTGTTTTCCTTGGTTTTTTTTCCGTAGAGGAGATGA ATGTACAACAAACTTCATAGTGATGCGTTGAGAGAAGCCATTTCATCTATATTTGCTGATAGCGGTGAAAAGAAGCGCAAATTCACCGAGACCATTGAACTTCATATTGGACTGAAGAACTATGATCCACAAAAGGACAAGCGTTTCAGTGGTTCAGTGAAGTTGCCGCATATCCCTCGCCCTAAGATGAAGATCTGCATTCTTGGAGATGTTTCACATGTTGAAGAGAGGAGATGA ATGTACAACAAACTTCATAGTGATGCGTTGAGAGAAGCCATTTCATCTATATTTGCTGATAGCGGTGAAAAGAAGCGCAAATTCACCGAGACCATTGAACTTCATATTGGACTGAAGAACTATGATCCACAAAAGGACAAGCGTTTCAGTGGTTCAGTGAAGTTGCCGCATATCCCTCGCCCTAAGATGAAGATCTGCATTCTTGGAGATGTTTCACATGTTGAAGAGAGGAGATGA MYNKLHSDALREAISSIFADSGEKKRKFTETIELHIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICILGDVSHVEERR* Homology
BLAST of CsaV3_1G043550 vs. NCBI nr
Match: KAE8653536.1 (hypothetical protein Csa_007457 [Cucumis sativus]) HSP 1 Score: 162.9 bits (411), Expect = 1.1e-36 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. NCBI nr
Match: XP_031736021.1 (60S ribosomal protein L10a-like [Cucumis sativus]) HSP 1 Score: 159.1 bits (401), Expect = 1.6e-35 Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. NCBI nr
Match: KAA0033405.1 (60S ribosomal protein L10a [Cucumis melo var. makuwa]) HSP 1 Score: 143.7 bits (361), Expect = 6.9e-31 Identity = 69/74 (93.24%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. NCBI nr
Match: XP_008458587.1 (PREDICTED: 60S ribosomal protein L10a [Cucumis melo] >XP_011657068.1 60S ribosomal protein L10a [Cucumis sativus] >KGN46947.1 hypothetical protein Csa_021060 [Cucumis sativus]) HSP 1 Score: 143.7 bits (361), Expect = 6.9e-31 Identity = 69/74 (93.24%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. NCBI nr
Match: XP_038893874.1 (60S ribosomal protein L10a [Benincasa hispida] >XP_038893875.1 60S ribosomal protein L10a [Benincasa hispida]) HSP 1 Score: 139.8 bits (351), Expect = 1.0e-29 Identity = 67/74 (90.54%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. ExPASy Swiss-Prot
Match: B8B9K6 (60S ribosomal protein L10a OS=Oryza sativa subsp. indica OX=39946 GN=RPL10A PE=3 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 9.8e-28 Identity = 56/74 (75.68%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. ExPASy Swiss-Prot
Match: B7F845 (60S ribosomal protein L10a OS=Oryza sativa subsp. japonica OX=39947 GN=RPL10A PE=1 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 9.8e-28 Identity = 56/74 (75.68%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. ExPASy Swiss-Prot
Match: P59230 (60S ribosomal protein L10a-2 OS=Arabidopsis thaliana OX=3702 GN=RPL10AB PE=1 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 2.8e-27 Identity = 57/74 (77.03%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. ExPASy Swiss-Prot
Match: Q8VZB9 (60S ribosomal protein L10a-1 OS=Arabidopsis thaliana OX=3702 GN=RPL10AA PE=1 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 8.3e-27 Identity = 57/74 (77.03%), Postives = 63/74 (85.14%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. ExPASy Swiss-Prot
Match: P59231 (60S ribosomal protein L10a-3 OS=Arabidopsis thaliana OX=3702 GN=RPL10AC PE=1 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.1e-26 Identity = 58/75 (77.33%), Postives = 63/75 (84.00%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. ExPASy TrEMBL
Match: A0A0A0M0B3 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G629190 PE=4 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 7.7e-36 Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. ExPASy TrEMBL
Match: A0A5A7SW61 (60S ribosomal protein L10a OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold111G00570 PE=3 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 3.4e-31 Identity = 69/74 (93.24%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. ExPASy TrEMBL
Match: A0A0A0KEW8 (Ribosomal protein OS=Cucumis sativus OX=3659 GN=Csa_6G152330 PE=3 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 3.4e-31 Identity = 69/74 (93.24%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. ExPASy TrEMBL
Match: A0A1S3C7Q8 (Ribosomal protein OS=Cucumis melo OX=3656 GN=LOC103497946 PE=3 SV=1) HSP 1 Score: 143.7 bits (361), Expect = 3.4e-31 Identity = 69/74 (93.24%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. ExPASy TrEMBL
Match: A0A5A7T1H8 (Ribosomal protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G003490 PE=3 SV=1) HSP 1 Score: 139.4 bits (350), Expect = 6.3e-30 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. TAIR 10
Match: AT2G27530.1 (Ribosomal protein L1p/L10e family ) HSP 1 Score: 122.1 bits (305), Expect = 2.0e-28 Identity = 57/74 (77.03%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. TAIR 10
Match: AT2G27530.2 (Ribosomal protein L1p/L10e family ) HSP 1 Score: 122.1 bits (305), Expect = 2.0e-28 Identity = 57/74 (77.03%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. TAIR 10
Match: AT1G08360.1 (Ribosomal protein L1p/L10e family ) HSP 1 Score: 120.6 bits (301), Expect = 5.9e-28 Identity = 57/74 (77.03%), Postives = 63/74 (85.14%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. TAIR 10
Match: AT5G22440.1 (Ribosomal protein L1p/L10e family ) HSP 1 Score: 118.6 bits (296), Expect = 2.2e-27 Identity = 58/75 (77.33%), Postives = 63/75 (84.00%), Query Frame = 0
BLAST of CsaV3_1G043550 vs. TAIR 10
Match: AT5G22440.2 (Ribosomal protein L1p/L10e family ) HSP 1 Score: 118.6 bits (296), Expect = 2.2e-27 Identity = 58/75 (77.33%), Postives = 63/75 (84.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|