CsaV3_1G030700 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTCTTTAAAAAATGGTGAAAATGTGAACTTTAGTGCTCCAAGGCCATTTGGGAAGAAGCTGAAATCGGATCTGAAAGAGACGTTTTTCCCTGATGATCCCTTCAAACAATTTCGAGATGAAAGTGGGGCAATGGATAGAGTGAAAAAGGGATTTCAATACTTCATACCTATTTTGCAATGGCTTCCTAAATACAATTTGAATATGTTTAAATATGATTTGCTTGCTGGTATTACCATTACCAGCCTTGCTATTCCTCAAGGCATTAGTTATGCCAAACTTGGCATTCTACCCCCCATTATCGGCCTTTGTTAG ATGGGTTCTTTAAAAAATGGTGAAAATGTGAACTTTAGTGCTCCAAGGCCATTTGGGAAGAAGCTGAAATCGGATCTGAAAGAGACGTTTTTCCCTGATGATCCCTTCAAACAATTTCGAGATGAAAGTGGGGCAATGGATAGAGTGAAAAAGGGATTTCAATACTTCATACCTATTTTGCAATGGCTTCCTAAATACAATTTGAATATGTTTAAATATGATTTGCTTGCTGGTATTACCATTACCAGCCTTGCTATTCCTCAAGGCATTAGTTATGCCAAACTTGGCATTCTACCCCCCATTATCGGCCTTTGTTAG ATGGGTTCTTTAAAAAATGGTGAAAATGTGAACTTTAGTGCTCCAAGGCCATTTGGGAAGAAGCTGAAATCGGATCTGAAAGAGACGTTTTTCCCTGATGATCCCTTCAAACAATTTCGAGATGAAAGTGGGGCAATGGATAGAGTGAAAAAGGGATTTCAATACTTCATACCTATTTTGCAATGGCTTCCTAAATACAATTTGAATATGTTTAAATATGATTTGCTTGCTGGTATTACCATTACCAGCCTTGCTATTCCTCAAGGCATTAGTTATGCCAAACTTGGCATTCTACCCCCCATTATCGGCCTTTGTTAG MGSLKNGENVNFSAPRPFGKKLKSDLKETFFPDDPFKQFRDESGAMDRVKKGFQYFIPILQWLPKYNLNMFKYDLLAGITITSLAIPQGISYAKLGILPPIIGLC* Homology
BLAST of CsaV3_1G030700 vs. NCBI nr
Match: KAE8653130.1 (hypothetical protein Csa_019857 [Cucumis sativus]) HSP 1 Score: 218.4 bits (555), Expect = 3.0e-53 Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. NCBI nr
Match: XP_031737048.1 (probable sulfate transporter 3.5 isoform X2 [Cucumis sativus]) HSP 1 Score: 214.9 bits (546), Expect = 3.3e-52 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. NCBI nr
Match: XP_031737046.1 (probable sulfate transporter 3.5 isoform X1 [Cucumis sativus]) HSP 1 Score: 214.9 bits (546), Expect = 3.3e-52 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. NCBI nr
Match: XP_031737105.1 (LOW QUALITY PROTEIN: probable sulfate transporter 3.5 [Cucumis sativus]) HSP 1 Score: 213.0 bits (541), Expect = 1.3e-51 Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. NCBI nr
Match: KAE8653127.1 (hypothetical protein Csa_019941 [Cucumis sativus]) HSP 1 Score: 208.4 bits (529), Expect = 3.1e-50 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. ExPASy Swiss-Prot
Match: Q94LW6 (Probable sulfate transporter 3.5 OS=Arabidopsis thaliana OX=3702 GN=SULTR3;5 PE=2 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 2.0e-31 Identity = 64/102 (62.75%), Postives = 74/102 (72.55%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. ExPASy Swiss-Prot
Match: Q9SV13 (Sulfate transporter 3.1 OS=Arabidopsis thaliana OX=3702 GN=SULTR3;1 PE=2 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.6e-25 Identity = 55/90 (61.11%), Postives = 70/90 (77.78%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. ExPASy Swiss-Prot
Match: Q9SXS2 (Probable sulfate transporter 3.3 OS=Arabidopsis thaliana OX=3702 GN=SULTR3;3 PE=2 SV=2) HSP 1 Score: 104.8 bits (260), Expect = 6.3e-22 Identity = 52/86 (60.47%), Postives = 65/86 (75.58%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. ExPASy Swiss-Prot
Match: O04289 (Sulfate transporter 3.2 OS=Arabidopsis thaliana OX=3702 GN=SULTR3;2 PE=2 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 5.3e-21 Identity = 48/95 (50.53%), Postives = 65/95 (68.42%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. ExPASy Swiss-Prot
Match: Q9LW86 (Probable sulfate transporter 3.4 OS=Arabidopsis thaliana OX=3702 GN=SULTR3;4 PE=2 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 3.6e-17 Identity = 43/85 (50.59%), Postives = 61/85 (71.76%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. ExPASy TrEMBL
Match: A0A0A0LU85 (Sulfate_transp domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G378520 PE=4 SV=1) HSP 1 Score: 214.9 bits (546), Expect = 1.6e-52 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. ExPASy TrEMBL
Match: A0A5D3BJU3 (Putative sulfate transporter 3.5 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold596G00430 PE=3 SV=1) HSP 1 Score: 203.0 bits (515), Expect = 6.3e-49 Identity = 96/104 (92.31%), Postives = 100/104 (96.15%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. ExPASy TrEMBL
Match: A0A5A7TZ58 (Putative sulfate transporter 3.5 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold114G001580 PE=3 SV=1) HSP 1 Score: 203.0 bits (515), Expect = 6.3e-49 Identity = 96/104 (92.31%), Postives = 100/104 (96.15%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. ExPASy TrEMBL
Match: A0A1S3CJ48 (probable sulfate transporter 3.5 OS=Cucumis melo OX=3656 GN=LOC103501545 PE=3 SV=1) HSP 1 Score: 203.0 bits (515), Expect = 6.3e-49 Identity = 96/104 (92.31%), Postives = 100/104 (96.15%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. ExPASy TrEMBL
Match: A0A6J1H8X4 (probable sulfate transporter 3.5 OS=Cucurbita moschata OX=3662 GN=LOC111461572 PE=3 SV=1) HSP 1 Score: 173.3 bits (438), Expect = 5.3e-40 Identity = 82/104 (78.85%), Postives = 93/104 (89.42%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. TAIR 10
Match: AT5G19600.1 (sulfate transporter 3;5 ) HSP 1 Score: 136.3 bits (342), Expect = 1.4e-32 Identity = 64/102 (62.75%), Postives = 74/102 (72.55%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. TAIR 10
Match: AT3G51895.1 (sulfate transporter 3;1 ) HSP 1 Score: 116.7 bits (291), Expect = 1.1e-26 Identity = 55/90 (61.11%), Postives = 70/90 (77.78%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. TAIR 10
Match: AT1G23090.1 (sulfate transporter 91 ) HSP 1 Score: 104.8 bits (260), Expect = 4.5e-23 Identity = 52/86 (60.47%), Postives = 65/86 (75.58%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. TAIR 10
Match: AT4G02700.1 (sulfate transporter 3;2 ) HSP 1 Score: 101.7 bits (252), Expect = 3.8e-22 Identity = 48/95 (50.53%), Postives = 65/95 (68.42%), Query Frame = 0
BLAST of CsaV3_1G030700 vs. TAIR 10
Match: AT3G15990.1 (sulfate transporter 3;4 ) HSP 1 Score: 89.0 bits (219), Expect = 2.5e-18 Identity = 43/85 (50.59%), Postives = 61/85 (71.76%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|