CsaV3_1G015240 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGGGGATTAGGGGCTGCATGGAAGGTGTTTGATGGAATGCACGATAGGAATGAGGTGTTGCGATCGGTTTTGATTGGGAGATTGGGGCAAGTGGAAGAAGAAGAGAAGTTGATAATGGAGATGGAGGTCGAGCCTGATAAGGGTTTGTGGGGTGCCATGTTGAGTGCTTGTAGGATTCATGGGAAGGCCGACGTTGCTGATAGGGTTCAAAAACGGTTTATGAAACAACAATGA ATGCGGGGATTAGGGGCTGCATGGAAGGTGTTTGATGGAATGCACGATAGGAATGAGGTGTTGCGATCGGTTTTGATTGGGAGATTGGGGCAAGTGGAAGAAGAAGAGAAGTTGATAATGGAGATGGAGGTCGAGCCTGATAAGGGTTTGTGGGGTGCCATGTTGAGTGCTTGTAGGATTCATGGGAAGGCCGACGTTGCTGATAGGGTTCAAAAACGGTTTATGAAACAACAATGA ATGCGGGGATTAGGGGCTGCATGGAAGGTGTTTGATGGAATGCACGATAGGAATGAGGTGTTGCGATCGGTTTTGATTGGGAGATTGGGGCAAGTGGAAGAAGAAGAGAAGTTGATAATGGAGATGGAGGTCGAGCCTGATAAGGGTTTGTGGGGTGCCATGTTGAGTGCTTGTAGGATTCATGGGAAGGCCGACGTTGCTGATAGGGTTCAAAAACGGTTTATGAAACAACAATGA MRGLGAAWKVFDGMHDRNEVLRSVLIGRLGQVEEEEKLIMEMEVEPDKGLWGAMLSACRIHGKADVADRVQKRFMKQQ* Homology
BLAST of CsaV3_1G015240 vs. NCBI nr
Match: KGN64972.1 (hypothetical protein Csa_022702 [Cucumis sativus]) HSP 1 Score: 161.8 bits (408), Expect = 2.5e-36 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. NCBI nr
Match: KAA0059103.1 (pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa] >TYJ99627.1 pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 99.4 bits (246), Expect = 1.5e-17 Identity = 46/54 (85.19%), Postives = 51/54 (94.44%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. NCBI nr
Match: XP_008455480.1 (PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis melo]) HSP 1 Score: 99.4 bits (246), Expect = 1.5e-17 Identity = 46/54 (85.19%), Postives = 51/54 (94.44%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. NCBI nr
Match: XP_004144516.1 (pentatricopeptide repeat-containing protein At3g46790, chloroplastic [Cucumis sativus] >KGN43485.1 hypothetical protein Csa_020556 [Cucumis sativus]) HSP 1 Score: 99.0 bits (245), Expect = 2.0e-17 Identity = 46/54 (85.19%), Postives = 50/54 (92.59%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. NCBI nr
Match: KAG7019344.1 (Pentatricopeptide repeat-containing protein, mitochondrial, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 96.3 bits (238), Expect = 1.3e-16 Identity = 44/53 (83.02%), Postives = 50/53 (94.34%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. ExPASy Swiss-Prot
Match: Q9M9E2 (Pentatricopeptide repeat-containing protein At1g15510, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-H73 PE=1 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 4.3e-07 Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. ExPASy Swiss-Prot
Match: Q9STF3 (Pentatricopeptide repeat-containing protein At3g46790, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CRR2 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 9.5e-07 Identity = 19/49 (38.78%), Postives = 34/49 (69.39%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. ExPASy Swiss-Prot
Match: Q9SV26 (Pentatricopeptide repeat-containing protein At4g01030, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-H65 PE=3 SV=2) HSP 1 Score: 53.9 bits (128), Expect = 9.5e-07 Identity = 26/74 (35.14%), Postives = 41/74 (55.41%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. ExPASy Swiss-Prot
Match: O81767 (Pentatricopeptide repeat-containing protein At4g33990 OS=Arabidopsis thaliana OX=3702 GN=EMB2758 PE=3 SV=2) HSP 1 Score: 53.5 bits (127), Expect = 1.2e-06 Identity = 21/42 (50.00%), Postives = 29/42 (69.05%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. ExPASy Swiss-Prot
Match: Q9FFG8 (Pentatricopeptide repeat-containing protein At5g44230 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H17 PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.2e-06 Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. ExPASy TrEMBL
Match: A0A0A0LVX2 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G169960 PE=4 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 1.2e-36 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. ExPASy TrEMBL
Match: A0A5A7UT42 (Pentatricopeptide repeat-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold786G00080 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 7.3e-18 Identity = 46/54 (85.19%), Postives = 51/54 (94.44%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. ExPASy TrEMBL
Match: A0A1S3C0K0 (pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like OS=Cucumis melo OX=3656 GN=LOC103495634 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 7.3e-18 Identity = 46/54 (85.19%), Postives = 51/54 (94.44%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. ExPASy TrEMBL
Match: A0A0A0K1F7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G041310 PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 9.5e-18 Identity = 46/54 (85.19%), Postives = 50/54 (92.59%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. ExPASy TrEMBL
Match: A0A6J1EHW3 (pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like OS=Cucurbita moschata OX=3662 GN=LOC111434233 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 1.8e-16 Identity = 43/53 (81.13%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TAIR 10
Match: AT1G15510.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 55.1 bits (131), Expect = 3.0e-08 Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TAIR 10
Match: AT3G46790.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 53.9 bits (128), Expect = 6.7e-08 Identity = 19/49 (38.78%), Postives = 34/49 (69.39%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TAIR 10
Match: AT4G01030.1 (pentatricopeptide (PPR) repeat-containing protein ) HSP 1 Score: 53.9 bits (128), Expect = 6.7e-08 Identity = 26/74 (35.14%), Postives = 41/74 (55.41%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TAIR 10
Match: AT4G33990.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 53.5 bits (127), Expect = 8.8e-08 Identity = 21/42 (50.00%), Postives = 29/42 (69.05%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TAIR 10
Match: AT5G44230.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 53.5 bits (127), Expect = 8.8e-08 Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|