CsaV3_1G009370 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AAATCAATCAATGGAGATGAACAATAGTCTCAAGATAGATCTAATCTCAACAGAGATAATAAAGCCTTCATCTCCAACACCTTCAACCCACCAACACCACAAACTTTCATTTCTTGACCAACCTGCCCCAGGCAGCTACACTCCTCTCCTCTTCTTCTACCCTGGTGGCGGCGACCACCGCGACCGGTGTCGGAAATTGAAGGAATCTCTCGCTTAA AATCAATCAATGGAGATGAACAATAGTCTCAAGATAGATCTAATCTCAACAGAGATAATAAAGCCTTCATCTCCAACACCTTCAACCCACCAACACCACAAACTTTCATTTCTTGACCAACCTGCCCCAGGCAGCTACACTCCTCTCCTCTTCTTCTACCCTGGTGGCGGCGACCACCGCGACCGGTGTCGGAAATTGAAGGAATCTCTCGCTTA AATCAATCAATGGAGATGAACAATAGTCTCAAGATAGATCTAATCTCAACAGAGATAATAAAGCCTTCATCTCCAACACCTTCAACCCACCAACACCACAAACTTTCATTTCTTGACCAACCTGCCCCAGGCAGCTACACTCCTCTCCTCTTCTTCTACCCTGGTGGCGGCGACCACCGCGACCGGTGTCGGAAATTGAAGGAATCTCTCGCTTA NQSMEMNNSLKIDLISTEIIKPSSPTPSTHQHHKLSFLDQPAPGSYTPLLFFYPGGGDHRDRCRKLKESLAX Homology
BLAST of CsaV3_1G009370 vs. NCBI nr
Match: KAE8652620.1 (hypothetical protein Csa_023792, partial [Cucumis sativus]) HSP 1 Score: 151.0 bits (380), Expect = 4.0e-33 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. NCBI nr
Match: XP_031744899.1 (stemmadenine O-acetyltransferase-like [Cucumis sativus] >KGN64382.1 hypothetical protein Csa_013637 [Cucumis sativus]) HSP 1 Score: 131.3 bits (329), Expect = 3.3e-27 Identity = 63/69 (91.30%), Postives = 66/69 (95.65%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. NCBI nr
Match: XP_008446186.1 (PREDICTED: vinorine synthase-like [Cucumis melo] >ADN33961.1 anthranilate N-benzoyltransferase [Cucumis melo subsp. melo] >KAA0055308.1 vinorine synthase-like [Cucumis melo var. makuwa] >TYJ99232.1 vinorine synthase-like [Cucumis melo var. makuwa]) HSP 1 Score: 129.4 bits (324), Expect = 1.2e-26 Identity = 61/68 (89.71%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. NCBI nr
Match: ADN33960.1 (anthranilate N-benzoyltransferase [Cucumis melo subsp. melo]) HSP 1 Score: 127.5 bits (319), Expect = 4.7e-26 Identity = 61/69 (88.41%), Postives = 64/69 (92.75%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. NCBI nr
Match: KAA0055309.1 (vinorine synthase-like [Cucumis melo var. makuwa] >TYJ99233.1 vinorine synthase-like [Cucumis melo var. makuwa]) HSP 1 Score: 127.5 bits (319), Expect = 4.7e-26 Identity = 61/69 (88.41%), Postives = 64/69 (92.75%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. ExPASy Swiss-Prot
Match: A0A2P1GIW7 (Stemmadenine O-acetyltransferase OS=Catharanthus roseus OX=4058 GN=SAT PE=1 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 2.5e-06 Identity = 27/65 (41.54%), Postives = 38/65 (58.46%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. ExPASy Swiss-Prot
Match: I3PLR4 ((13S,14R)-1,13-dihydroxy-N-methylcanadine 13-O-acetyltransferase AT1 OS=Papaver somniferum OX=3469 GN=AT1 PE=1 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 7.3e-06 Identity = 27/75 (36.00%), Postives = 40/75 (53.33%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. ExPASy Swiss-Prot
Match: Q94FT4 (Salutaridinol 7-O-acetyltransferase OS=Papaver somniferum OX=3469 GN=SALAT PE=1 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 9.6e-06 Identity = 29/71 (40.85%), Postives = 40/71 (56.34%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. ExPASy Swiss-Prot
Match: D2Y3X2 (Acyltransferase Pun1 OS=Capsicum annuum OX=4072 GN=PUN1 PE=1 SV=1) HSP 1 Score: 48.9 bits (115), Expect = 2.8e-05 Identity = 22/43 (51.16%), Postives = 27/43 (62.79%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. ExPASy Swiss-Prot
Match: Q58VT1 (Acyltransferase Pun1 OS=Capsicum frutescens OX=4073 GN=PUN1 PE=3 SV=1) HSP 1 Score: 48.9 bits (115), Expect = 2.8e-05 Identity = 22/43 (51.16%), Postives = 26/43 (60.47%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. ExPASy TrEMBL
Match: A0A0A0LUA9 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G050210 PE=3 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 1.6e-27 Identity = 63/69 (91.30%), Postives = 66/69 (95.65%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. ExPASy TrEMBL
Match: A0A5A7UJX0 (Vinorine synthase-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold248G004430 PE=3 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 6.0e-27 Identity = 61/68 (89.71%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. ExPASy TrEMBL
Match: E5GBW2 (Anthranilate N-benzoyltransferase OS=Cucumis melo subsp. melo OX=412675 PE=3 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 6.0e-27 Identity = 61/68 (89.71%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. ExPASy TrEMBL
Match: A0A1S3BF49 (vinorine synthase-like OS=Cucumis melo OX=3656 GN=LOC103488987 PE=3 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 6.0e-27 Identity = 61/68 (89.71%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. ExPASy TrEMBL
Match: A0A5A7UPB9 (Vinorine synthase-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold248G004440 PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 2.3e-26 Identity = 61/69 (88.41%), Postives = 64/69 (92.75%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TAIR 10
Match: AT3G26040.1 (HXXXD-type acyl-transferase family protein ) HSP 1 Score: 53.5 bits (127), Expect = 8.0e-08 Identity = 25/64 (39.06%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TAIR 10
Match: AT4G15390.1 (HXXXD-type acyl-transferase family protein ) HSP 1 Score: 46.2 bits (108), Expect = 1.3e-05 Identity = 27/65 (41.54%), Postives = 34/65 (52.31%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TAIR 10
Match: AT1G24430.1 (HXXXD-type acyl-transferase family protein ) HSP 1 Score: 45.8 bits (107), Expect = 1.7e-05 Identity = 29/66 (43.94%), Postives = 38/66 (57.58%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TAIR 10
Match: AT5G23970.1 (HXXXD-type acyl-transferase family protein ) HSP 1 Score: 43.5 bits (101), Expect = 8.3e-05 Identity = 24/62 (38.71%), Postives = 37/62 (59.68%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TAIR 10
Match: AT1G24420.1 (HXXXD-type acyl-transferase family protein ) HSP 1 Score: 42.4 bits (98), Expect = 1.9e-04 Identity = 25/66 (37.88%), Postives = 35/66 (53.03%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|