CsaV3_1G005450 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGAGGAACATACAGTGATGCTTCATGGAATGTGGGCTAGCCCTTTTGTGAAAGGGGTCGAACTTGCCCTCAAAATCAAAGTCATTACTATTGAATCTGTGGAAGAAGATCTCCAAAACAAAACTCCAGAGCTTCTGAGCTTCAATCCCATTTACAAGAATGTTTCTGTACTGATCCACAGTGGAAAACCCATTTGTGAATCACTGGTGATTCTTGAAAACATCAACTAA ATGGCAGAGGAACATACAGTGATGCTTCATGGAATGTGGGCTAGCCCTTTTGTGAAAGGGGTCGAACTTGCCCTCAAAATCAAAGTCATTACTATTGAATCTGTGGAAGAAGATCTCCAAAACAAAACTCCAGAGCTTCTGAGCTTCAATCCCATTTACAAGAATGTTTCTGTACTGATCCACAGTGGAAAACCCATTTGTGAATCACTGGTGATTCTTGAAAACATCAACTAA ATGGCAGAGGAACATACAGTGATGCTTCATGGAATGTGGGCTAGCCCTTTTGTGAAAGGGGTCGAACTTGCCCTCAAAATCAAAGTCATTACTATTGAATCTGTGGAAGAAGATCTCCAAAACAAAACTCCAGAGCTTCTGAGCTTCAATCCCATTTACAAGAATGTTTCTGTACTGATCCACAGTGGAAAACCCATTTGTGAATCACTGGTGATTCTTGAAAACATCAACTAA MAEEHTVMLHGMWASPFVKGVELALKIKVITIESVEEDLQNKTPELLSFNPIYKNVSVLIHSGKPICESLVILENIN* Homology
BLAST of CsaV3_1G005450 vs. NCBI nr
Match: KGN63997.1 (hypothetical protein Csa_013653 [Cucumis sativus]) HSP 1 Score: 155.6 bits (392), Expect = 1.7e-34 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. NCBI nr
Match: XP_023519915.1 (glutathione S-transferase U9-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 112.8 bits (281), Expect = 1.3e-21 Identity = 52/77 (67.53%), Postives = 65/77 (84.42%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. NCBI nr
Match: XP_038896026.1 (glutathione S-transferase U9-like [Benincasa hispida]) HSP 1 Score: 112.8 bits (281), Expect = 1.3e-21 Identity = 54/76 (71.05%), Postives = 63/76 (82.89%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. NCBI nr
Match: XP_022923757.1 (glutathione S-transferase U9-like [Cucurbita moschata] >KAG6584459.1 Glutathione S-transferase U9, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 112.5 bits (280), Expect = 1.7e-21 Identity = 52/77 (67.53%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. NCBI nr
Match: XP_023001350.1 (glutathione S-transferase U9-like [Cucurbita maxima]) HSP 1 Score: 112.1 bits (279), Expect = 2.2e-21 Identity = 52/77 (67.53%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. ExPASy Swiss-Prot
Match: P46421 (Glutathione S-transferase U5 OS=Arabidopsis thaliana OX=3702 GN=GSTU5 PE=2 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.5e-17 Identity = 46/77 (59.74%), Postives = 58/77 (75.32%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. ExPASy Swiss-Prot
Match: Q9FUT0 (Glutathione S-transferase U9 OS=Arabidopsis thaliana OX=3702 GN=GSTU9 PE=2 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 7.6e-17 Identity = 40/74 (54.05%), Postives = 58/74 (78.38%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. ExPASy Swiss-Prot
Match: Q9CA57 (Glutathione S-transferase U10 OS=Arabidopsis thaliana OX=3702 GN=GSTU10 PE=2 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.7e-16 Identity = 39/71 (54.93%), Postives = 53/71 (74.65%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. ExPASy Swiss-Prot
Match: Q9ZW24 (Glutathione S-transferase U7 OS=Arabidopsis thaliana OX=3702 GN=GSTU7 PE=2 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 4.2e-15 Identity = 38/71 (53.52%), Postives = 54/71 (76.06%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. ExPASy Swiss-Prot
Match: Q9ZW30 (Glutathione S-transferase U1 OS=Arabidopsis thaliana OX=3702 GN=GSTU1 PE=2 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 5.5e-15 Identity = 43/78 (55.13%), Postives = 56/78 (71.79%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. ExPASy TrEMBL
Match: A0A0A0LTD4 (GST N-terminal domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G033170 PE=4 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 8.4e-35 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. ExPASy TrEMBL
Match: A0A6J1E712 (glutathione S-transferase U9-like OS=Cucurbita moschata OX=3662 GN=LOC111431369 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 8.2e-22 Identity = 52/77 (67.53%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. ExPASy TrEMBL
Match: A0A6J1KKY3 (glutathione S-transferase U9-like OS=Cucurbita maxima OX=3661 GN=LOC111495508 PE=3 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 1.1e-21 Identity = 52/77 (67.53%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. ExPASy TrEMBL
Match: A0A6J1AJV0 (glutathione S-transferase U9-like OS=Herrania umbratica OX=108875 GN=LOC110418680 PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 5.3e-21 Identity = 52/77 (67.53%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. ExPASy TrEMBL
Match: A0A6P5YCQ6 (glutathione S-transferase U9-like OS=Durio zibethinus OX=66656 GN=LOC111291028 PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 5.3e-21 Identity = 52/77 (67.53%), Postives = 63/77 (81.82%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. TAIR 10
Match: AT2G29450.1 (glutathione S-transferase tau 5 ) HSP 1 Score: 88.2 bits (217), Expect = 3.2e-18 Identity = 46/77 (59.74%), Postives = 58/77 (75.32%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. TAIR 10
Match: AT5G62480.1 (glutathione S-transferase tau 9 ) HSP 1 Score: 87.4 bits (215), Expect = 5.4e-18 Identity = 40/74 (54.05%), Postives = 58/74 (78.38%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. TAIR 10
Match: AT1G74590.1 (glutathione S-transferase TAU 10 ) HSP 1 Score: 86.3 bits (212), Expect = 1.2e-17 Identity = 39/71 (54.93%), Postives = 53/71 (74.65%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. TAIR 10
Match: AT2G29420.1 (glutathione S-transferase tau 7 ) HSP 1 Score: 81.6 bits (200), Expect = 3.0e-16 Identity = 38/71 (53.52%), Postives = 54/71 (76.06%), Query Frame = 0
BLAST of CsaV3_1G005450 vs. TAIR 10
Match: AT2G29490.1 (glutathione S-transferase TAU 1 ) HSP 1 Score: 81.3 bits (199), Expect = 3.9e-16 Identity = 43/78 (55.13%), Postives = 56/78 (71.79%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|