CsGy7G021365 (gene) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGCATTAAGCTGACATATGGAGTAAACAAATATTGGCAAGCAGACCCATTTCTTCCCAAAGCATATCCGTGGAGTGGCTTAATCTGTGACAATGAGACTGCTCCAAAAAATAATCACTGTAGGTGCATTCATTCCTAAAAATTGTGCATTACATATTTGATGTCCATTGGAATTAGAGTATAAAATGAAATAAGCTACTGTAATTTTTTATTAGGGACTTATCATCAAGTGACCTGACGGGTGAAATATCTCCTTATATATTCAACTTATCCATGTTACAAACTTTGTGAGTATCTTTGTACCCAAACTGTTAGATCAACCAATCCCCCTAAAAACTATTCAATGCCAAGGAAGAAGAACTAAATGATTTTGTTTTCAGAGACTTGTCGAGTAATAGCCTATCAGGAAATGTACCTGATTTCTTGGCCAATATGAAAAGCCTCAAAGTCATGTAA ATGAGCATTAAGCTGACATATGGAGTAAACAAATATTGGCAAGCAGACCCATTTCTTCCCAAAGCATATCCGTGGAGTGGCTTAATCTGTGACAATGAGACTGCTCCAAAAAATAATCACTGTAGGGACTTATCATCAAGTGACCTGACGGGTGAAATATCTCCTTATATATTCAACTTATCCATGTTACAAACTTTAGACTTGTCGAGTAATAGCCTATCAGGAAATGTACCTGATTTCTTGGCCAATATGAAAAGCCTCAAAGTCATGTAA ATGAGCATTAAGCTGACATATGGAGTAAACAAATATTGGCAAGCAGACCCATTTCTTCCCAAAGCATATCCGTGGAGTGGCTTAATCTGTGACAATGAGACTGCTCCAAAAAATAATCACTGTAGGGACTTATCATCAAGTGACCTGACGGGTGAAATATCTCCTTATATATTCAACTTATCCATGTTACAAACTTTAGACTTGTCGAGTAATAGCCTATCAGGAAATGTACCTGATTTCTTGGCCAATATGAAAAGCCTCAAAGTCATGTAA MSIKLTYGVNKYWQADPFLPKAYPWSGLICDNETAPKNNHCRDLSSSDLTGEISPYIFNLSMLQTLDLSSNSLSGNVPDFLANMKSLKVM* Homology
BLAST of CsGy7G021365 vs. ExPASy Swiss-Prot
Match: Q9C8I6 (LRR receptor-like serine/threonine-protein kinase IOS1 OS=Arabidopsis thaliana OX=3702 GN=IOS1 PE=1 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.8e-18 Identity = 52/94 (55.32%), Postives = 69/94 (73.40%), Query Frame = 0
BLAST of CsGy7G021365 vs. ExPASy Swiss-Prot
Match: C0LGD9 (Probable LRR receptor-like serine/threonine-protein kinase At1g07560 OS=Arabidopsis thaliana OX=3702 GN=At1g07560 PE=1 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 5.2e-17 Identity = 46/92 (50.00%), Postives = 63/92 (68.48%), Query Frame = 0
BLAST of CsGy7G021365 vs. ExPASy Swiss-Prot
Match: C0LGR6 (Probable LRR receptor-like serine/threonine-protein kinase At4g29180 OS=Arabidopsis thaliana OX=3702 GN=At4g29180 PE=1 SV=2) HSP 1 Score: 85.9 bits (211), Expect = 2.6e-16 Identity = 43/87 (49.43%), Postives = 57/87 (65.52%), Query Frame = 0
BLAST of CsGy7G021365 vs. ExPASy Swiss-Prot
Match: Q9SI06 (Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana OX=3702 GN=At2g04300 PE=3 SV=2) HSP 1 Score: 85.9 bits (211), Expect = 2.6e-16 Identity = 47/92 (51.09%), Postives = 63/92 (68.48%), Query Frame = 0
BLAST of CsGy7G021365 vs. ExPASy Swiss-Prot
Match: C0LGD6 (Probable LRR receptor-like serine/threonine-protein kinase At1g05700 OS=Arabidopsis thaliana OX=3702 GN=At1g05700 PE=1 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 4.4e-16 Identity = 42/90 (46.67%), Postives = 58/90 (64.44%), Query Frame = 0
BLAST of CsGy7G021365 vs. NCBI nr
Match: KGN45553.1 (hypothetical protein Csa_016794 [Cucumis sativus]) HSP 1 Score: 189 bits (481), Expect = 9.53e-61 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 0
BLAST of CsGy7G021365 vs. NCBI nr
Match: XP_038898021.1 (LRR receptor-like serine/threonine-protein kinase IOS1 isoform X4 [Benincasa hispida] >XP_038898022.1 LRR receptor-like serine/threonine-protein kinase IOS1 isoform X4 [Benincasa hispida]) HSP 1 Score: 150 bits (379), Expect = 7.17e-40 Identity = 76/90 (84.44%), Postives = 81/90 (90.00%), Query Frame = 0
BLAST of CsGy7G021365 vs. NCBI nr
Match: XP_038898020.1 (LRR receptor-like serine/threonine-protein kinase IOS1 isoform X3 [Benincasa hispida]) HSP 1 Score: 150 bits (379), Expect = 8.32e-40 Identity = 76/90 (84.44%), Postives = 81/90 (90.00%), Query Frame = 0
BLAST of CsGy7G021365 vs. NCBI nr
Match: XP_038898019.1 (LRR receptor-like serine/threonine-protein kinase IOS1 isoform X2 [Benincasa hispida]) HSP 1 Score: 150 bits (379), Expect = 8.39e-40 Identity = 76/90 (84.44%), Postives = 81/90 (90.00%), Query Frame = 0
BLAST of CsGy7G021365 vs. NCBI nr
Match: XP_038898018.1 (LRR receptor-like serine/threonine-protein kinase IOS1 isoform X1 [Benincasa hispida]) HSP 1 Score: 150 bits (379), Expect = 8.51e-40 Identity = 76/90 (84.44%), Postives = 81/90 (90.00%), Query Frame = 0
BLAST of CsGy7G021365 vs. ExPASy TrEMBL
Match: A0A0A0K7X8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G452080 PE=4 SV=1) HSP 1 Score: 189 bits (481), Expect = 4.61e-61 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 0
BLAST of CsGy7G021365 vs. ExPASy TrEMBL
Match: A0A0A0KCS6 (Protein kinase domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_7G452210 PE=4 SV=1) HSP 1 Score: 110 bits (275), Expect = 4.51e-26 Identity = 52/89 (58.43%), Postives = 68/89 (76.40%), Query Frame = 0
BLAST of CsGy7G021365 vs. ExPASy TrEMBL
Match: A0A6J1CSB5 (LRR receptor-like serine/threonine-protein kinase IOS1 isoform X2 OS=Momordica charantia OX=3673 GN=LOC111013870 PE=4 SV=1) HSP 1 Score: 108 bits (271), Expect = 1.57e-25 Identity = 51/89 (57.30%), Postives = 67/89 (75.28%), Query Frame = 0
BLAST of CsGy7G021365 vs. ExPASy TrEMBL
Match: A0A6J1CSQ6 (LRR receptor-like serine/threonine-protein kinase IOS1 isoform X1 OS=Momordica charantia OX=3673 GN=LOC111013870 PE=4 SV=1) HSP 1 Score: 108 bits (271), Expect = 1.57e-25 Identity = 51/89 (57.30%), Postives = 67/89 (75.28%), Query Frame = 0
BLAST of CsGy7G021365 vs. ExPASy TrEMBL
Match: A0A6J1JWM5 (LRR receptor-like serine/threonine-protein kinase IOS1 OS=Cucurbita maxima OX=3661 GN=LOC111488544 PE=4 SV=1) HSP 1 Score: 108 bits (270), Expect = 2.15e-25 Identity = 53/89 (59.55%), Postives = 67/89 (75.28%), Query Frame = 0
BLAST of CsGy7G021365 vs. TAIR 10
Match: AT1G51800.1 (Leucine-rich repeat protein kinase family protein ) HSP 1 Score: 92.4 bits (228), Expect = 2.0e-19 Identity = 52/94 (55.32%), Postives = 69/94 (73.40%), Query Frame = 0
BLAST of CsGy7G021365 vs. TAIR 10
Match: AT1G07560.1 (Leucine-rich repeat protein kinase family protein ) HSP 1 Score: 88.2 bits (217), Expect = 3.7e-18 Identity = 46/92 (50.00%), Postives = 63/92 (68.48%), Query Frame = 0
BLAST of CsGy7G021365 vs. TAIR 10
Match: AT1G49100.1 (Leucine-rich repeat protein kinase family protein ) HSP 1 Score: 87.4 bits (215), Expect = 6.3e-18 Identity = 46/91 (50.55%), Postives = 65/91 (71.43%), Query Frame = 0
BLAST of CsGy7G021365 vs. TAIR 10
Match: AT4G29450.1 (Leucine-rich repeat protein kinase family protein ) HSP 1 Score: 87.0 bits (214), Expect = 8.3e-18 Identity = 46/92 (50.00%), Postives = 59/92 (64.13%), Query Frame = 0
BLAST of CsGy7G021365 vs. TAIR 10
Match: AT2G04300.1 (Leucine-rich repeat protein kinase family protein ) HSP 1 Score: 85.9 bits (211), Expect = 1.8e-17 Identity = 47/92 (51.09%), Postives = 63/92 (68.48%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Gy14) v2.1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|