CsGy7G006307 (gene) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: five_prime_UTRexonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CAAAGAGAAAACACAGAGGAAAATAATGAGTTATTATAACCAGCCACCGCCTTCCGTCGGCGTTCCTCCTCCGCCGCATGGTAACATCTAAGAATCAACCATATTATTACTCTTTCATCATCATCTCTTACATTTAATCTACACTTTGTTTACGAAATTAGGGTTTTGCCAAACACACATACCTATTTTTACTTTTGTTTGAAAATGTTTTTGTCAAACACAAATACAAATTTTTAAGCAAACATACCTTTCATCTCGATTTGACTGATTTTGACGATTTTAGGTTATCCACTATCGACGATGACGCCGTCAGGGTATCCACTGCAGGGCGGCTATCCTCCACAAGGATATCCACCTCCATCGACGCACGGTCATCCTCCACCGCAACATGTACATCAAGACCAAAAGAAAGATGGATGCTTCAAACGCTGGTAAGTGATCTCTTGCTTCTCTTTCATTTTACAACTCTTAAAATGTATTCTTAATTTGTTTTTAATAATATATTTAAATTGTTAAATAGATAATTTTATATTTTAAAAATAAGTTAAATGATTTTTATTATTTATTATATCCTATCAATTTCGTTATAATGAAAACTCAGTTCATTATCATTCACGATGTCCACCTCTTTCAAACGTCGTCTAATACGATATGTTTGTGAAAATTTATTATTATTTAGCCATTTTTTTTATCTTTTTAATTTTCTTGTAAATTTTGTAGGTTTTATGAAATACTTTCGTGGACACCTTAA CAAAGAGAAAACACAGAGGAAAATAATGAGTTATTATAACCAGCCACCGCCTTCCGTCGGCGTTCCTCCTCCGCCGCATGGTTATCCACTATCGACGATGACGCCGTCAGGGTATCCACTGCAGGGCGGCTATCCTCCACAAGGATATCCACCTCCATCGACGCACGGTCATCCTCCACCGCAACATGTACATCAAGACCAAAAGAAAGATGGATGCTTCAAACGCTGGTTTTATGAAATACTTTCGTGGACACCTTAA ATGAGTTATTATAACCAGCCACCGCCTTCCGTCGGCGTTCCTCCTCCGCCGCATGGTTATCCACTATCGACGATGACGCCGTCAGGGTATCCACTGCAGGGCGGCTATCCTCCACAAGGATATCCACCTCCATCGACGCACGGTCATCCTCCACCGCAACATGTACATCAAGACCAAAAGAAAGATGGATGCTTCAAACGCTGGTTTTATGAAATACTTTCGTGGACACCTTAA MSYYNQPPPSVGVPPPPHGYPLSTMTPSGYPLQGGYPPQGYPPPSTHGHPPPQHVHQDQKKDGCFKRWFYEILSWTP* Homology
BLAST of CsGy7G006307 vs. ExPASy Swiss-Prot
Match: Q8S8M0 (Cysteine-rich and transmembrane domain-containing protein WIH2 OS=Arabidopsis thaliana OX=3702 GN=WIH2 PE=1 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 3.8e-08 Identity = 38/81 (46.91%), Postives = 39/81 (48.15%), Query Frame = 0
BLAST of CsGy7G006307 vs. ExPASy Swiss-Prot
Match: P31356 (Rhodopsin OS=Todarodes pacificus OX=6637 GN=RHO PE=1 SV=2) HSP 1 Score: 45.1 bits (105), Expect = 4.4e-04 Identity = 26/43 (60.47%), Postives = 26/43 (60.47%), Query Frame = 0
BLAST of CsGy7G006307 vs. NCBI nr
Match: XP_031745117.1 (cysteine-rich and transmembrane domain-containing protein WIH2-like [Cucumis sativus] >KAE8645841.1 hypothetical protein Csa_017279 [Cucumis sativus]) HSP 1 Score: 174 bits (442), Expect = 3.34e-55 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of CsGy7G006307 vs. NCBI nr
Match: KAA0031374.1 (cysteine-rich and transmembrane domain-containing protein A-like [Cucumis melo var. makuwa] >TYK06826.1 cysteine-rich and transmembrane domain-containing protein A-like [Cucumis melo var. makuwa]) HSP 1 Score: 90.5 bits (223), Expect = 7.54e-22 Identity = 51/81 (62.96%), Postives = 53/81 (65.43%), Query Frame = 0
BLAST of CsGy7G006307 vs. NCBI nr
Match: XP_038888865.1 (cysteine-rich and transmembrane domain-containing protein WIH2-like [Benincasa hispida]) HSP 1 Score: 84.7 bits (208), Expect = 1.62e-19 Identity = 46/76 (60.53%), Postives = 52/76 (68.42%), Query Frame = 0
BLAST of CsGy7G006307 vs. NCBI nr
Match: PHU21261.1 (Cysteine-rich and transmembrane domain-containing protein 1 [Capsicum chinense]) HSP 1 Score: 72.0 bits (175), Expect = 2.46e-14 Identity = 42/84 (50.00%), Postives = 46/84 (54.76%), Query Frame = 0
BLAST of CsGy7G006307 vs. NCBI nr
Match: XP_022148715.1 (cysteine-rich and transmembrane domain-containing protein WIH2-like [Momordica charantia]) HSP 1 Score: 72.0 bits (175), Expect = 2.66e-14 Identity = 43/79 (54.43%), Postives = 46/79 (58.23%), Query Frame = 0
BLAST of CsGy7G006307 vs. ExPASy TrEMBL
Match: A0A5D3C924 (Cysteine-rich and transmembrane domain-containing protein A-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold13G001300 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 3.65e-22 Identity = 51/81 (62.96%), Postives = 53/81 (65.43%), Query Frame = 0
BLAST of CsGy7G006307 vs. ExPASy TrEMBL
Match: A0A6J1D3P4 (cysteine-rich and transmembrane domain-containing protein WIH2-like OS=Momordica charantia OX=3673 GN=LOC111017311 PE=3 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 1.29e-14 Identity = 43/79 (54.43%), Postives = 46/79 (58.23%), Query Frame = 0
BLAST of CsGy7G006307 vs. ExPASy TrEMBL
Match: A0A6J1I9Y5 (cysteine-rich and transmembrane domain-containing protein WIH2-like OS=Cucurbita maxima OX=3661 GN=LOC111470998 PE=4 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 4.82e-14 Identity = 42/76 (55.26%), Postives = 47/76 (61.84%), Query Frame = 0
BLAST of CsGy7G006307 vs. ExPASy TrEMBL
Match: A0A5A7SME1 (Cysteine-rich and transmembrane domain-containing protein A-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold13G001290 PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 5.86e-14 Identity = 41/82 (50.00%), Postives = 47/82 (57.32%), Query Frame = 0
BLAST of CsGy7G006307 vs. ExPASy TrEMBL
Match: A0A6J0MSF4 (cysteine-rich and transmembrane domain-containing protein A-like isoform X1 OS=Raphanus sativus OX=3726 GN=LOC108845806 PE=4 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 7.49e-14 Identity = 41/81 (50.62%), Postives = 50/81 (61.73%), Query Frame = 0
BLAST of CsGy7G006307 vs. TAIR 10
Match: AT2G41420.1 (proline-rich family protein ) HSP 1 Score: 58.5 bits (140), Expect = 2.7e-09 Identity = 38/81 (46.91%), Postives = 39/81 (48.15%), Query Frame = 0
BLAST of CsGy7G006307 vs. TAIR 10
Match: AT3G49845.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: root; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 43.1 bits (100), Expect = 1.2e-04 Identity = 20/35 (57.14%), Postives = 26/35 (74.29%), Query Frame = 0
BLAST of CsGy7G006307 vs. TAIR 10
Match: AT1G31750.1 (proline-rich family protein ) HSP 1 Score: 42.4 bits (98), Expect = 2.0e-04 Identity = 22/37 (59.46%), Postives = 23/37 (62.16%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Gy14) v2.1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|