CsGy6G014805 (gene) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGGTTCATGGAACGGAAATGAAAATCAAAGTAAGAGGAGTTTTAATCACAACCATCAAATCCACTCGGAGCAACGATCCAACGGTCCACAATCGAAGACATTCTAGATTTCGTTACACGCAAAACATCCATCTCGTATCCGACGAAATCTATTCCGGTTCCGTTTTCTCCTCCGACGAGTTCACAAGCGTCGCCGAGGTTTTGGAATCTCGCGGCTATAAAAACGCCGAACGTGTACACATCGTCTACAGTCTCTCCAAAGACCTCGGCCTTCCGGTTCAGAGTCGGCACGATCTATTCATACAACGATAA ATGTCGGTTCATGGAACGGAAATGAAAATCAAAGTAAGAGGAGTTTTAATCACAACCATCAAATCCACTCGGAGCAACGATCCAACGGTCCACAATCGAAGACATTCTAGATTTCGTTACACGCAAAACATCCATCTCGTATCCGACGAAATCTATTCCGGTTCCGTTTTCTCCTCCGACGAGTTCACAAGCGTCGCCGAGGTTTTGGAATCTCGCGGCTATAAAAACGCCGAACGTGTACACATCGTCTACAGTCTCTCCAAAGACCTCGGCCTTCCGGTTCAGAGTCGGCACGATCTATTCATACAACGATAA ATGTCGGTTCATGGAACGGAAATGAAAATCAAAGTAAGAGGAGTTTTAATCACAACCATCAAATCCACTCGGAGCAACGATCCAACGGTCCACAATCGAAGACATTCTAGATTTCGTTACACGCAAAACATCCATCTCGTATCCGACGAAATCTATTCCGGTTCCGTTTTCTCCTCCGACGAGTTCACAAGCGTCGCCGAGGTTTTGGAATCTCGCGGCTATAAAAACGCCGAACGTGTACACATCGTCTACAGTCTCTCCAAAGACCTCGGCCTTCCGGTTCAGAGTCGGCACGATCTATTCATACAACGATAA MSVHGTEMKIKVRGVLITTIKSTRSNDPTVHNRRHSRFRYTQNIHLVSDEIYSGSVFSSDEFTSVAEVLESRGYKNAERVHIVYSLSKDLGLPVQSRHDLFIQR* Homology
BLAST of CsGy6G014805 vs. ExPASy Swiss-Prot
Match: Q9STR4 (1-aminocyclopropane-1-carboxylate synthase 7 OS=Arabidopsis thaliana OX=3702 GN=ACS7 PE=1 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.4e-13 Identity = 50/91 (54.95%), Postives = 59/91 (64.84%), Query Frame = 0
BLAST of CsGy6G014805 vs. ExPASy Swiss-Prot
Match: Q9M2Y8 (1-aminocyclopropane-1-carboxylate synthase 9 OS=Arabidopsis thaliana OX=3702 GN=ACS9 PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.8e-13 Identity = 45/94 (47.87%), Postives = 63/94 (67.02%), Query Frame = 0
BLAST of CsGy6G014805 vs. ExPASy Swiss-Prot
Match: Q9T065 (1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana OX=3702 GN=ACS8 PE=1 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 4.0e-13 Identity = 45/91 (49.45%), Postives = 58/91 (63.74%), Query Frame = 0
BLAST of CsGy6G014805 vs. ExPASy Swiss-Prot
Match: Q42881 (1-aminocyclopropane-1-carboxylate synthase 3 OS=Solanum lycopersicum OX=4081 GN=ACS3 PE=1 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 2.6e-12 Identity = 46/91 (50.55%), Postives = 55/91 (60.44%), Query Frame = 0
BLAST of CsGy6G014805 vs. ExPASy Swiss-Prot
Match: Q43309 (1-aminocyclopropane-1-carboxylate synthase 4 OS=Arabidopsis thaliana OX=3702 GN=ACS4 PE=1 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.5e-12 Identity = 44/93 (47.31%), Postives = 59/93 (63.44%), Query Frame = 0
BLAST of CsGy6G014805 vs. NCBI nr
Match: KAE8646987.1 (hypothetical protein Csa_017013 [Cucumis sativus]) HSP 1 Score: 120 bits (301), Expect = 2.39e-32 Identity = 70/99 (70.71%), Postives = 74/99 (74.75%), Query Frame = 0
BLAST of CsGy6G014805 vs. NCBI nr
Match: AKE47618.1 (1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]) HSP 1 Score: 114 bits (285), Expect = 9.43e-28 Identity = 67/94 (71.28%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of CsGy6G014805 vs. NCBI nr
Match: NP_001292629.1 (1-aminocyclopropane-1-carboxylate synthase 7 [Cucumis sativus] >ACT78790.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >ACT78957.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >ACT78958.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >KAE8637457.1 hypothetical protein CSA_004490 [Cucumis sativus] >BAF79596.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]) HSP 1 Score: 114 bits (285), Expect = 2.36e-27 Identity = 67/94 (71.28%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of CsGy6G014805 vs. NCBI nr
Match: ACT78959.1 (1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >ACT78960.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus] >ACT78961.1 1-aminocyclopropane-1-carboxylate synthase [Cucumis sativus]) HSP 1 Score: 114 bits (285), Expect = 2.36e-27 Identity = 67/94 (71.28%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of CsGy6G014805 vs. NCBI nr
Match: XP_031738416.1 (LOW QUALITY PROTEIN: 1-aminocyclopropane-1-carboxylate synthase 7-like [Cucumis sativus]) HSP 1 Score: 112 bits (280), Expect = 1.22e-26 Identity = 66/94 (70.21%), Postives = 70/94 (74.47%), Query Frame = 0
BLAST of CsGy6G014805 vs. ExPASy TrEMBL
Match: A0A0K0MK36 (1-aminocyclopropane-1-carboxylate synthase OS=Cucumis sativus OX=3659 GN=ACS2 PE=3 SV=1) HSP 1 Score: 114 bits (285), Expect = 4.57e-28 Identity = 67/94 (71.28%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of CsGy6G014805 vs. ExPASy TrEMBL
Match: A8ASI7 (1-aminocyclopropane-1-carboxylate synthase OS=Cucumis sativus OX=3659 GN=ACS2 PE=2 SV=1) HSP 1 Score: 114 bits (285), Expect = 1.14e-27 Identity = 67/94 (71.28%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of CsGy6G014805 vs. ExPASy TrEMBL
Match: C7BFM6 (1-aminocyclopropane-1-carboxylate synthase OS=Cucumis sativus OX=3659 GN=ACS2 PE=3 SV=1) HSP 1 Score: 114 bits (285), Expect = 1.14e-27 Identity = 67/94 (71.28%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of CsGy6G014805 vs. ExPASy TrEMBL
Match: A0A0A0M1V3 (Aminotran_1_2 domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G580750 PE=3 SV=1) HSP 1 Score: 112 bits (280), Expect = 5.90e-27 Identity = 66/94 (70.21%), Postives = 70/94 (74.47%), Query Frame = 0
BLAST of CsGy6G014805 vs. ExPASy TrEMBL
Match: B2WR82 (1-aminocyclopropane-1-carboxylate synthase (Fragment) OS=Citrullus colocynthis x Citrullus lanatus var. lanatus OX=433968 GN=ACS4 PE=3 SV=1) HSP 1 Score: 107 bits (267), Expect = 1.11e-26 Identity = 64/92 (69.57%), Postives = 68/92 (73.91%), Query Frame = 0
BLAST of CsGy6G014805 vs. TAIR 10
Match: AT4G26200.1 (1-amino-cyclopropane-1-carboxylate synthase 7 ) HSP 1 Score: 77.0 bits (188), Expect = 9.9e-15 Identity = 50/91 (54.95%), Postives = 59/91 (64.84%), Query Frame = 0
BLAST of CsGy6G014805 vs. TAIR 10
Match: AT3G49700.1 (1-aminocyclopropane-1-carboxylate synthase 9 ) HSP 1 Score: 76.6 bits (187), Expect = 1.3e-14 Identity = 45/94 (47.87%), Postives = 63/94 (67.02%), Query Frame = 0
BLAST of CsGy6G014805 vs. TAIR 10
Match: AT4G37770.1 (1-amino-cyclopropane-1-carboxylate synthase 8 ) HSP 1 Score: 75.5 bits (184), Expect = 2.9e-14 Identity = 45/91 (49.45%), Postives = 58/91 (63.74%), Query Frame = 0
BLAST of CsGy6G014805 vs. TAIR 10
Match: AT2G22810.1 (1-aminocyclopropane-1-carboxylate synthase 4 ) HSP 1 Score: 72.0 bits (175), Expect = 3.2e-13 Identity = 44/93 (47.31%), Postives = 59/93 (63.44%), Query Frame = 0
BLAST of CsGy6G014805 vs. TAIR 10
Match: AT4G08040.1 (1-aminocyclopropane-1-carboxylate synthase 11 ) HSP 1 Score: 71.2 bits (173), Expect = 5.4e-13 Identity = 41/85 (48.24%), Postives = 52/85 (61.18%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Gy14) v2.1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|