![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CsGy6G012060 (gene) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTAATTGGATTGATTGGTGCAGACACGTGGTTCTCCCACCCGAAGTGGCAAAGTTGTTTCCTAAGAATCGTCTGCTCTCGGAAGTAAGCAATTTTGTTTTCTTAGTTTCAAATTTATGTGTCTTGATTTTGTTACGAAAGGAAGAATTATCTTATTGATTGAGAAGAAACTTAGTTCAATAGTTGAATTCTTATTTCCTGTTTAGGTATCACTCTTGAGAGACCCTATGAAATAGATATTATTATGTGGACAATTTTTCCCCTTATTTCTAATCTTTTATATTTTCATATGATCTTGATATTCTCTCTTTGATTTGACTGATGGTTGCATGAAGTTGAAACGATGTTTTTGAGTATTTCGGATAGAAGTTATATGAAAAAGGATTGAGAATTGAGGGCTTATGACTTATTCATTAGACTAAATCCCTTCTGATTTGCCAATTGTGCAATTCCCTCTATGCAATTAGTGAGCAATGGACGCTTCTGTTGGGCATAAGCATAGGAACATTATCATCTTTGATTTTCTTGGCTTTCTTATTGAACTCAAGTTAGTTGTTCTAAACAAAAGGGTGCTTTCCAAATCTGTTTTACTACTCGTTTCATGGAAGCATTTTGTTATACTCTTAGACCTTTAATCTTATGTGCAGAATGAATGGCGTGCAATTGGAGTCCAGCAGAGTCGTGGGTGGGTGCACTATGCTTTTCATTGTCCCGAACCTCATATCATGCTATTCAGGAGGCCCCTGAACTACCAACAGCAACAGGAGAATCGCACTCAACAAAATGCACTTGCTGCTAAATGA ATGTCTAATTGGATTGATTGGTGCAGACACGTGGTTCTCCCACCCGAAGTGGCAAAGTTGTTTCCTAAGAATCGTCTGCTCTCGGAAAATGAATGGCGTGCAATTGGAGTCCAGCAGAGTCGTGGGTGGGTGCACTATGCTTTTCATTGTCCCGAACCTCATATCATGCTATTCAGGAGGCCCCTGAACTACCAACAGCAACAGGAGAATCGCACTCAACAAAATGCACTTGCTGCTAAATGA ATGTCTAATTGGATTGATTGGTGCAGACACGTGGTTCTCCCACCCGAAGTGGCAAAGTTGTTTCCTAAGAATCGTCTGCTCTCGGAAAATGAATGGCGTGCAATTGGAGTCCAGCAGAGTCGTGGGTGGGTGCACTATGCTTTTCATTGTCCCGAACCTCATATCATGCTATTCAGGAGGCCCCTGAACTACCAACAGCAACAGGAGAATCGCACTCAACAAAATGCACTTGCTGCTAAATGA MSNWIDWCRHVVLPPEVAKLFPKNRLLSENEWRAIGVQQSRGWVHYAFHCPEPHIMLFRRPLNYQQQQENRTQQNALAAK* Homology
BLAST of CsGy6G012060 vs. ExPASy Swiss-Prot
Match: O23249 (Cyclin-dependent kinases regulatory subunit 1 OS=Arabidopsis thaliana OX=3702 GN=CKS1 PE=1 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 3.7e-30 Identity = 60/65 (92.31%), Postives = 61/65 (93.85%), Query Frame = 0
BLAST of CsGy6G012060 vs. ExPASy Swiss-Prot
Match: A2XCH8 (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. indica OX=39946 GN=CKS1 PE=2 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.5e-28 Identity = 57/61 (93.44%), Postives = 58/61 (95.08%), Query Frame = 0
BLAST of CsGy6G012060 vs. ExPASy Swiss-Prot
Match: Q6PS57 (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CKS1 PE=2 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.5e-28 Identity = 57/61 (93.44%), Postives = 58/61 (95.08%), Query Frame = 0
BLAST of CsGy6G012060 vs. ExPASy Swiss-Prot
Match: Q9SJJ5 (Cyclin-dependent kinases regulatory subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CKS2 PE=1 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 6.5e-27 Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
BLAST of CsGy6G012060 vs. ExPASy Swiss-Prot
Match: P55933 (Probable cyclin-dependent kinases regulatory subunit OS=Physarum polycephalum OX=5791 PE=1 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 3.4e-20 Identity = 41/52 (78.85%), Postives = 46/52 (88.46%), Query Frame = 0
BLAST of CsGy6G012060 vs. NCBI nr
Match: KGN46891.1 (hypothetical protein Csa_021096 [Cucumis sativus]) HSP 1 Score: 177 bits (450), Expect = 2.49e-56 Identity = 80/80 (100.00%), Postives = 80/80 (100.00%), Query Frame = 0
BLAST of CsGy6G012060 vs. NCBI nr
Match: XP_011657043.1 (LOW QUALITY PROTEIN: cyclin-dependent kinases regulatory subunit 1 [Cucumis sativus]) HSP 1 Score: 155 bits (391), Expect = 3.30e-47 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsGy6G012060 vs. NCBI nr
Match: XP_008465423.1 (PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Cucumis melo] >KAA0037300.1 cyclin-dependent kinases regulatory subunit 1-like [Cucumis melo var. makuwa] >TYK24184.1 cyclin-dependent kinases regulatory subunit 1-like [Cucumis melo var. makuwa]) HSP 1 Score: 145 bits (367), Expect = 1.52e-43 Identity = 69/72 (95.83%), Postives = 69/72 (95.83%), Query Frame = 0
BLAST of CsGy6G012060 vs. NCBI nr
Match: XP_038902899.1 (cyclin-dependent kinases regulatory subunit 1-like [Benincasa hispida]) HSP 1 Score: 139 bits (351), Expect = 4.18e-41 Identity = 66/72 (91.67%), Postives = 66/72 (91.67%), Query Frame = 0
BLAST of CsGy6G012060 vs. NCBI nr
Match: XP_018854502.1 (cyclin-dependent kinases regulatory subunit 1-like [Juglans regia] >XP_040991781.1 cyclin-dependent kinases regulatory subunit 1-like [Juglans microcarpa x Juglans regia] >XP_042955613.1 cyclin-dependent kinases regulatory subunit 1 [Carya illinoinensis] >XP_042955614.1 cyclin-dependent kinases regulatory subunit 1 [Carya illinoinensis] >KAG2674589.1 hypothetical protein I3760_13G143300 [Carya illinoinensis] >KAG6632237.1 hypothetical protein CIPAW_13G144800 [Carya illinoinensis] >KAG6682493.1 hypothetical protein I3842_13G144400 [Carya illinoinensis] >KAG7950678.1 hypothetical protein I3843_13G127600 [Carya illinoinensis]) HSP 1 Score: 139 bits (350), Expect = 5.77e-41 Identity = 65/70 (92.86%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of CsGy6G012060 vs. ExPASy TrEMBL
Match: A0A0A0KGK5 (Cyclin-dependent kinases regulatory subunit OS=Cucumis sativus OX=3659 GN=Csa_6G148330 PE=3 SV=1) HSP 1 Score: 177 bits (450), Expect = 1.21e-56 Identity = 80/80 (100.00%), Postives = 80/80 (100.00%), Query Frame = 0
BLAST of CsGy6G012060 vs. ExPASy TrEMBL
Match: A0A5D3DKQ6 (Cyclin-dependent kinases regulatory subunit OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1754G00180 PE=3 SV=1) HSP 1 Score: 145 bits (367), Expect = 7.34e-44 Identity = 69/72 (95.83%), Postives = 69/72 (95.83%), Query Frame = 0
BLAST of CsGy6G012060 vs. ExPASy TrEMBL
Match: A0A1S3CNU7 (Cyclin-dependent kinases regulatory subunit OS=Cucumis melo OX=3656 GN=LOC103503041 PE=3 SV=1) HSP 1 Score: 145 bits (367), Expect = 7.34e-44 Identity = 69/72 (95.83%), Postives = 69/72 (95.83%), Query Frame = 0
BLAST of CsGy6G012060 vs. ExPASy TrEMBL
Match: A0A2I4GKZ4 (Cyclin-dependent kinases regulatory subunit OS=Juglans regia OX=51240 GN=LOC109016561 PE=3 SV=1) HSP 1 Score: 139 bits (350), Expect = 2.79e-41 Identity = 65/70 (92.86%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of CsGy6G012060 vs. ExPASy TrEMBL
Match: A0A6J1K8L9 (Cyclin-dependent kinases regulatory subunit OS=Cucurbita maxima OX=3661 GN=LOC111491633 PE=3 SV=1) HSP 1 Score: 138 bits (348), Expect = 5.81e-41 Identity = 65/72 (90.28%), Postives = 66/72 (91.67%), Query Frame = 0
BLAST of CsGy6G012060 vs. TAIR 10
Match: AT2G27960.1 (cyclin-dependent kinase-subunit 1 ) HSP 1 Score: 131.7 bits (330), Expect = 2.6e-31 Identity = 60/65 (92.31%), Postives = 61/65 (93.85%), Query Frame = 0
BLAST of CsGy6G012060 vs. TAIR 10
Match: AT2G27970.1 (CDK-subunit 2 ) HSP 1 Score: 120.9 bits (302), Expect = 4.6e-28 Identity = 53/61 (86.89%), Postives = 57/61 (93.44%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Gy14) v2.1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|