
CsGy5G024835 (gene) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGCAGTTTCAAGCAGTTTCCATGAATCCAATTCTTCAATTTTCACCTACTAAAACCAAATTCCCTTCTTCTTCTTCTTCTTCTTCTTCTTCACCATTTTTCTTCACCAAAACAAGAACCTCTGTTTCTCAAAAAGTTTCCATTAGGTACTCTGTTTTCTGTTCATCACCACTAACCAACAATTATATAAACTAAAAAAACCAACATTGTTGATTGACAGTCAAGGTTACAAGATGGATGGGTACCAAGATTTTGAGCTCAAAGTTCGTGATTACGAGCTGGATCAATTCGGTGTAGTCAACAATGCTGTTTATGCAGATTATTGCTACCATGGTCAAGCTGATCTAAACTCGAAACTTCTGTTAAATTGA ATGTTGCAGTTTCAAGCAGTTTCCATGAATCCAATTCTTCAATTTTCACCTACTAAAACCAAATTCCCTTCTTCTTCTTCTTCTTCTTCTTCTTCACCATTTTTCTTCACCAAAACAAGAACCTCTGTTTCTCAAAAAGTTTCCATTAGTCAAGGTTACAAGATGGATGGGTACCAAGATTTTGAGCTCAAAGTTCGTGATTACGAGCTGGATCAATTCGGTGTAGTCAACAATGCTGTTTATGCAGATTATTGCTACCATGGTCAAGCTGATCTAAACTCGAAACTTCTGTTAAATTGA ATGTTGCAGTTTCAAGCAGTTTCCATGAATCCAATTCTTCAATTTTCACCTACTAAAACCAAATTCCCTTCTTCTTCTTCTTCTTCTTCTTCTTCACCATTTTTCTTCACCAAAACAAGAACCTCTGTTTCTCAAAAAGTTTCCATTAGTCAAGGTTACAAGATGGATGGGTACCAAGATTTTGAGCTCAAAGTTCGTGATTACGAGCTGGATCAATTCGGTGTAGTCAACAATGCTGTTTATGCAGATTATTGCTACCATGGTCAAGCTGATCTAAACTCGAAACTTCTGTTAAATTGA MLQFQAVSMNPILQFSPTKTKFPSSSSSSSSSPFFFTKTRTSVSQKVSISQGYKMDGYQDFELKVRDYELDQFGVVNNAVYADYCYHGQADLNSKLLLN* Homology
BLAST of CsGy5G024835 vs. ExPASy Swiss-Prot
Match: Q9C7I5 (Acyl-acyl carrier protein thioesterase ATL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ALT1 PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 5.2e-10 Identity = 41/79 (51.90%), Postives = 48/79 (60.76%), Query Frame = 0
BLAST of CsGy5G024835 vs. ExPASy Swiss-Prot
Match: Q9C7I8 (Acyl-acyl carrier protein thioesterase ATL2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ALT2 PE=2 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 6.8e-10 Identity = 27/43 (62.79%), Postives = 34/43 (79.07%), Query Frame = 0
BLAST of CsGy5G024835 vs. ExPASy Swiss-Prot
Match: F4HX80 (Acyl-acyl carrier protein thioesterase ATL4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ALT4 PE=2 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 6.8e-10 Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of CsGy5G024835 vs. ExPASy Swiss-Prot
Match: Q8W583 (Acyl-acyl carrier protein thioesterase ATL3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ALT3 PE=2 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.5e-09 Identity = 28/48 (58.33%), Postives = 35/48 (72.92%), Query Frame = 0
BLAST of CsGy5G024835 vs. ExPASy Swiss-Prot
Match: S4TE15 (Acyl-acyl carrier protein thioesterase TE3, chloroplastic OS=Humulus lupulus OX=3486 GN=TE3 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.6e-09 Identity = 45/107 (42.06%), Postives = 57/107 (53.27%), Query Frame = 0
BLAST of CsGy5G024835 vs. NCBI nr
Match: XP_011655778.1 (acyl-acyl carrier protein thioesterase ATL3, chloroplastic isoform X1 [Cucumis sativus] >XP_031741192.1 acyl-acyl carrier protein thioesterase ATL3, chloroplastic isoform X2 [Cucumis sativus]) HSP 1 Score: 179 bits (453), Expect = 8.65e-55 Identity = 90/96 (93.75%), Postives = 93/96 (96.88%), Query Frame = 0
BLAST of CsGy5G024835 vs. NCBI nr
Match: XP_008446608.1 (PREDICTED: acyl-acyl carrier protein thioesterase ATL3, chloroplastic-like [Cucumis melo] >KAA0034567.1 acyl-acyl carrier protein thioesterase ATL3 [Cucumis melo var. makuwa]) HSP 1 Score: 160 bits (405), Expect = 1.68e-47 Identity = 80/96 (83.33%), Postives = 89/96 (92.71%), Query Frame = 0
BLAST of CsGy5G024835 vs. NCBI nr
Match: XP_038893138.1 (acyl-acyl carrier protein thioesterase ATL3, chloroplastic-like [Benincasa hispida]) HSP 1 Score: 135 bits (341), Expect = 6.00e-38 Identity = 69/96 (71.88%), Postives = 78/96 (81.25%), Query Frame = 0
BLAST of CsGy5G024835 vs. NCBI nr
Match: XP_038893060.1 (acyl-acyl carrier protein thioesterase ATL4, chloroplastic-like [Benincasa hispida]) HSP 1 Score: 129 bits (323), Expect = 3.57e-35 Identity = 68/96 (70.83%), Postives = 76/96 (79.17%), Query Frame = 0
BLAST of CsGy5G024835 vs. NCBI nr
Match: KAE8648792.1 (hypothetical protein Csa_009266 [Cucumis sativus]) HSP 1 Score: 91.7 bits (226), Expect = 5.50e-19 Identity = 40/47 (85.11%), Postives = 44/47 (93.62%), Query Frame = 0
BLAST of CsGy5G024835 vs. ExPASy TrEMBL
Match: A0A0A0KR74 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G609790 PE=4 SV=1) HSP 1 Score: 165 bits (418), Expect = 6.80e-50 Identity = 82/88 (93.18%), Postives = 85/88 (96.59%), Query Frame = 0
BLAST of CsGy5G024835 vs. ExPASy TrEMBL
Match: A0A5A7SZ57 (Acyl-acyl carrier protein thioesterase ATL3 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold65G005830 PE=4 SV=1) HSP 1 Score: 160 bits (405), Expect = 8.15e-48 Identity = 80/96 (83.33%), Postives = 89/96 (92.71%), Query Frame = 0
BLAST of CsGy5G024835 vs. ExPASy TrEMBL
Match: A0A1S3BGA0 (acyl-acyl carrier protein thioesterase ATL3, chloroplastic-like OS=Cucumis melo OX=3656 GN=LOC103489291 PE=4 SV=1) HSP 1 Score: 160 bits (405), Expect = 8.15e-48 Identity = 80/96 (83.33%), Postives = 89/96 (92.71%), Query Frame = 0
BLAST of CsGy5G024835 vs. ExPASy TrEMBL
Match: A0A5D3CCR4 (Acyl-acyl carrier protein thioesterase ATL3 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold475G001110 PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 2.35e-18 Identity = 38/47 (80.85%), Postives = 44/47 (93.62%), Query Frame = 0
BLAST of CsGy5G024835 vs. ExPASy TrEMBL
Match: A0A6J1G0B9 (acyl-acyl carrier protein thioesterase ATL3, chloroplastic-like OS=Cucurbita moschata OX=3662 GN=LOC111449530 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 7.57e-16 Identity = 37/61 (60.66%), Postives = 44/61 (72.13%), Query Frame = 0
BLAST of CsGy5G024835 vs. TAIR 10
Match: AT1G35290.1 (Thioesterase superfamily protein ) HSP 1 Score: 65.1 bits (157), Expect = 3.7e-11 Identity = 41/79 (51.90%), Postives = 48/79 (60.76%), Query Frame = 0
BLAST of CsGy5G024835 vs. TAIR 10
Match: AT1G68280.1 (Thioesterase superfamily protein ) HSP 1 Score: 64.7 bits (156), Expect = 4.8e-11 Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = 0
BLAST of CsGy5G024835 vs. TAIR 10
Match: AT1G35250.1 (Thioesterase superfamily protein ) HSP 1 Score: 64.7 bits (156), Expect = 4.8e-11 Identity = 27/43 (62.79%), Postives = 34/43 (79.07%), Query Frame = 0
BLAST of CsGy5G024835 vs. TAIR 10
Match: AT1G68260.1 (Thioesterase superfamily protein ) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-10 Identity = 28/48 (58.33%), Postives = 35/48 (72.92%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Gy14) v2.1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|