![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CsGy3G030170 (gene) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTTGCTGTGGCGGAAACTGTGGATGCGGCTCTGGCTGCAAGTGCGGAAATGGCTGTGGAGGGTGAGTAACCTCTCGCCAATTAACTCTTTTGAGTTTGATCGAGTGAAATTGCTTTTAGTTCGCGTATGATTTTGTGGAGAGCATGATCTCTCGAGAATCTGATCTTCTGTTTTCTTTTACATCGCTTTCGATTTCTTAATCTTCTACATATCTTTGTCCCTCGTTCGACGGCGATCCGATCACTTGCCGATTATCTTCATTCGTACGATCAAGGCGGATTTTCTTGTGAAGTTTCTGAAAATGACTACGGTGTTCATTTCACCCGAGGATAATCGCGATGATTCTGATGTTTTGATATTTTGTCATGCAGATGCAAGAGTTTCCCTGACTTGAGCTTCTCAGAGACCTCTGCTACGATCGACACTTTCGTAGTCGGTTTCGCTCCTCAGAAGATGTAAGTTTCTGCAATCAAGCCTAATTTTTCAAGAGAGGTTTCGGTATTTAGTGATGATTTTATTTAACAATATCGGCGTTTTCGATACCAGGTCCTACGAGGTAGCAGAGATGGGAGCCGAGAACGGCTGCAAGTGCGGTGACAACTGCACCTGCGATCCATGCACCTGTAAATGA ATGTCTTGCTGTGGCGGAAACTGTGGATGCGGCTCTGGCTGCAAGTGCGGAAATGGCTGTGGAGGATGCAAGAGTTTCCCTGACTTGAGCTTCTCAGAGACCTCTGCTACGATCGACACTTTCGTAGTCGGTTTCGCTCCTCAGAAGATGTCCTACGAGGTAGCAGAGATGGGAGCCGAGAACGGCTGCAAGTGCGGTGACAACTGCACCTGCGATCCATGCACCTGTAAATGA ATGTCTTGCTGTGGCGGAAACTGTGGATGCGGCTCTGGCTGCAAGTGCGGAAATGGCTGTGGAGGATGCAAGAGTTTCCCTGACTTGAGCTTCTCAGAGACCTCTGCTACGATCGACACTTTCGTAGTCGGTTTCGCTCCTCAGAAGATGTCCTACGAGGTAGCAGAGATGGGAGCCGAGAACGGCTGCAAGTGCGGTGACAACTGCACCTGCGATCCATGCACCTGTAAATGA MSCCGGNCGCGSGCKCGNGCGGCKSFPDLSFSETSATIDTFVVGFAPQKMSYEVAEMGAENGCKCGDNCTCDPCTCK* Homology
BLAST of CsGy3G030170 vs. ExPASy Swiss-Prot
Match: Q40158 (Metallothionein-like protein type 2 B OS=Solanum lycopersicum OX=4081 GN=MTB PE=2 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.4e-26 Identity = 52/80 (65.00%), Postives = 63/80 (78.75%), Query Frame = 0
BLAST of CsGy3G030170 vs. ExPASy Swiss-Prot
Match: P30564 (Metallothionein-like protein type 2 OS=Ricinus communis OX=3988 GN=MTI PE=3 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.4e-26 Identity = 55/81 (67.90%), Postives = 63/81 (77.78%), Query Frame = 0
BLAST of CsGy3G030170 vs. ExPASy Swiss-Prot
Match: Q41657 (Metallothionein-like protein type 2 OS=Vicia faba OX=3906 GN=MTI PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.5e-25 Identity = 54/78 (69.23%), Postives = 63/78 (80.77%), Query Frame = 0
BLAST of CsGy3G030170 vs. ExPASy Swiss-Prot
Match: P43390 (Metallothionein-like protein type 2 OS=Actinidia deliciosa OX=3627 GN=pKIWI504 PE=2 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 7.6e-25 Identity = 53/79 (67.09%), Postives = 62/79 (78.48%), Query Frame = 0
BLAST of CsGy3G030170 vs. ExPASy Swiss-Prot
Match: P43398 (Metallothionein-like protein 2 OS=Trifolium repens OX=3899 GN=MT1A PE=3 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 1.0e-24 Identity = 55/78 (70.51%), Postives = 61/78 (78.21%), Query Frame = 0
BLAST of CsGy3G030170 vs. NCBI nr
Match: XP_004137793.1 (metallothionein-like protein type 2 isoform X2 [Cucumis sativus] >KGN58873.1 hypothetical protein Csa_000742 [Cucumis sativus]) HSP 1 Score: 166 bits (419), Expect = 1.09e-51 Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of CsGy3G030170 vs. NCBI nr
Match: XP_008442554.1 (PREDICTED: metallothionein-like protein type 2 [Cucumis melo]) HSP 1 Score: 162 bits (410), Expect = 2.57e-50 Identity = 74/77 (96.10%), Postives = 76/77 (98.70%), Query Frame = 0
BLAST of CsGy3G030170 vs. NCBI nr
Match: XP_031737741.1 (metallothionein-like protein type 2 isoform X1 [Cucumis sativus]) HSP 1 Score: 160 bits (404), Expect = 2.38e-49 Identity = 76/81 (93.83%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of CsGy3G030170 vs. NCBI nr
Match: KAA0044088.1 (metallothionein-like protein type 2 [Cucumis melo var. makuwa] >TYK25049.1 metallothionein-like protein type 2 [Cucumis melo var. makuwa]) HSP 1 Score: 157 bits (397), Expect = 2.87e-48 Identity = 72/75 (96.00%), Postives = 74/75 (98.67%), Query Frame = 0
BLAST of CsGy3G030170 vs. NCBI nr
Match: XP_038906044.1 (metallothionein-like protein type 2 [Benincasa hispida]) HSP 1 Score: 156 bits (395), Expect = 5.00e-48 Identity = 70/77 (90.91%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of CsGy3G030170 vs. ExPASy TrEMBL
Match: A0A0A0LAK4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G734260 PE=3 SV=1) HSP 1 Score: 166 bits (419), Expect = 5.25e-52 Identity = 76/77 (98.70%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of CsGy3G030170 vs. ExPASy TrEMBL
Match: A0A1S3B6L7 (metallothionein-like protein type 2 OS=Cucumis melo OX=3656 GN=LOC103486389 PE=3 SV=1) HSP 1 Score: 162 bits (410), Expect = 1.24e-50 Identity = 74/77 (96.10%), Postives = 76/77 (98.70%), Query Frame = 0
BLAST of CsGy3G030170 vs. ExPASy TrEMBL
Match: A0A5D3DP05 (Metallothionein-like protein type 2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold352G001700 PE=3 SV=1) HSP 1 Score: 157 bits (397), Expect = 1.39e-48 Identity = 72/75 (96.00%), Postives = 74/75 (98.67%), Query Frame = 0
BLAST of CsGy3G030170 vs. ExPASy TrEMBL
Match: A0A6J1I8Z4 (metallothionein-like protein type 2 OS=Cucurbita maxima OX=3661 GN=LOC111470252 PE=3 SV=1) HSP 1 Score: 154 bits (388), Expect = 2.83e-47 Identity = 69/77 (89.61%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of CsGy3G030170 vs. ExPASy TrEMBL
Match: A0A6J1GBI9 (metallothionein-like protein type 2 OS=Cucurbita moschata OX=3662 GN=LOC111452655 PE=3 SV=1) HSP 1 Score: 154 bits (388), Expect = 2.83e-47 Identity = 69/77 (89.61%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of CsGy3G030170 vs. TAIR 10
Match: AT3G09390.1 (metallothionein 2A ) HSP 1 Score: 110.5 bits (275), Expect = 6.0e-25 Identity = 54/81 (66.67%), Postives = 60/81 (74.07%), Query Frame = 0
BLAST of CsGy3G030170 vs. TAIR 10
Match: AT5G02380.1 (metallothionein 2B ) HSP 1 Score: 91.7 bits (226), Expect = 2.9e-19 Identity = 50/81 (61.73%), Postives = 58/81 (71.60%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Gy14) v2.1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|