![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CsGy3G028460 (gene) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGGCTTGTGTAAGGTCGGCAGATCAGACGAGGCAATGGAATTGCTCAATGAAGCGGAGGAAAATGGTTTAAAACCAAGTGTTGTCACTTTCAACACCCTCTTCAATGGATTCACCTTCATCAGAGCGTTATGCAGGACATCCTTGAAAGAAAAGGATGTATTGGAAGATGCCCATCAACTGTTTAAGAAAATGAAGGCCTGCTGA ATGGATGGCTTGTGTAAGGTCGGCAGATCAGACGAGGCAATGGAATTGCTCAATGAAGCGGAGGAAAATGGTTTAAAACCAAGTGTTGTCACTTTCAACACCCTCTTCAATGGATTCACCTTCATCAGAGCGTTATGCAGGACATCCTTGAAAGAAAAGGATGTATTGGAAGATGCCCATCAACTGTTTAAGAAAATGAAGGCCTGCTGA ATGGATGGCTTGTGTAAGGTCGGCAGATCAGACGAGGCAATGGAATTGCTCAATGAAGCGGAGGAAAATGGTTTAAAACCAAGTGTTGTCACTTTCAACACCCTCTTCAATGGATTCACCTTCATCAGAGCGTTATGCAGGACATCCTTGAAAGAAAAGGATGTATTGGAAGATGCCCATCAACTGTTTAAGAAAATGAAGGCCTGCTGA MDGLCKVGRSDEAMELLNEAEENGLKPSVVTFNTLFNGFTFIRALCRTSLKEKDVLEDAHQLFKKMKAC* Homology
BLAST of CsGy3G028460 vs. ExPASy Swiss-Prot
Match: Q9M9X9 (Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g06710 PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 7.1e-06 Identity = 21/42 (50.00%), Postives = 31/42 (73.81%), Query Frame = 0
BLAST of CsGy3G028460 vs. ExPASy Swiss-Prot
Match: Q76C99 (Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica OX=39946 GN=Rf1 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 7.1e-06 Identity = 28/68 (41.18%), Postives = 42/68 (61.76%), Query Frame = 0
BLAST of CsGy3G028460 vs. ExPASy Swiss-Prot
Match: Q9C8T7 (Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana OX=3702 GN=At1g63330 PE=2 SV=2) HSP 1 Score: 49.7 bits (117), Expect = 1.6e-05 Identity = 25/67 (37.31%), Postives = 40/67 (59.70%), Query Frame = 0
BLAST of CsGy3G028460 vs. ExPASy Swiss-Prot
Match: Q9LUR2 (Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g16710 PE=3 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.6e-05 Identity = 24/67 (35.82%), Postives = 39/67 (58.21%), Query Frame = 0
BLAST of CsGy3G028460 vs. ExPASy Swiss-Prot
Match: Q9LVQ5 (Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana OX=3702 GN=At5g55840 PE=3 SV=2) HSP 1 Score: 49.7 bits (117), Expect = 1.6e-05 Identity = 21/39 (53.85%), Postives = 29/39 (74.36%), Query Frame = 0
BLAST of CsGy3G028460 vs. NCBI nr
Match: KAE8650970.1 (hypothetical protein Csa_000996 [Cucumis sativus]) HSP 1 Score: 142 bits (359), Expect = 8.88e-43 Identity = 68/69 (98.55%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of CsGy3G028460 vs. NCBI nr
Match: XP_022157329.1 (pentatricopeptide repeat-containing protein At1g09900-like [Momordica charantia]) HSP 1 Score: 97.8 bits (242), Expect = 9.65e-22 Identity = 59/131 (45.04%), Postives = 65/131 (49.62%), Query Frame = 0
BLAST of CsGy3G028460 vs. NCBI nr
Match: XP_023528121.1 (pentatricopeptide repeat-containing protein At5g39710-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 95.1 bits (235), Expect = 8.24e-21 Identity = 57/131 (43.51%), Postives = 65/131 (49.62%), Query Frame = 0
BLAST of CsGy3G028460 vs. NCBI nr
Match: KAG7017186.1 (Pentatricopeptide repeat-containing protein, mitochondrial, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 95.1 bits (235), Expect = 8.24e-21 Identity = 57/131 (43.51%), Postives = 65/131 (49.62%), Query Frame = 0
BLAST of CsGy3G028460 vs. NCBI nr
Match: KAG6580429.1 (Pentatricopeptide repeat-containing protein, mitochondrial, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 94.0 bits (232), Expect = 2.14e-20 Identity = 56/131 (42.75%), Postives = 65/131 (49.62%), Query Frame = 0
BLAST of CsGy3G028460 vs. ExPASy TrEMBL
Match: A0A0A0LF40 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G728080 PE=4 SV=1) HSP 1 Score: 127 bits (320), Expect = 9.77e-37 Identity = 61/62 (98.39%), Postives = 62/62 (100.00%), Query Frame = 0
BLAST of CsGy3G028460 vs. ExPASy TrEMBL
Match: A0A6J1DW66 (pentatricopeptide repeat-containing protein At1g09900-like OS=Momordica charantia OX=3673 GN=LOC111024057 PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 4.67e-22 Identity = 59/131 (45.04%), Postives = 65/131 (49.62%), Query Frame = 0
BLAST of CsGy3G028460 vs. ExPASy TrEMBL
Match: A0A6J1F9P1 (pentatricopeptide repeat-containing protein At1g09900-like OS=Cucurbita moschata OX=3662 GN=LOC111442091 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.03e-20 Identity = 56/131 (42.75%), Postives = 65/131 (49.62%), Query Frame = 0
BLAST of CsGy3G028460 vs. ExPASy TrEMBL
Match: A0A6J1J506 (pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like OS=Cucurbita maxima OX=3661 GN=LOC111481420 PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 3.68e-20 Identity = 56/131 (42.75%), Postives = 64/131 (48.85%), Query Frame = 0
BLAST of CsGy3G028460 vs. ExPASy TrEMBL
Match: A0A1S3B7W4 (pentatricopeptide repeat-containing protein At5g39710-like OS=Cucumis melo OX=3656 GN=LOC103487124 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.04e-16 Identity = 36/39 (92.31%), Postives = 38/39 (97.44%), Query Frame = 0
BLAST of CsGy3G028460 vs. TAIR 10
Match: AT1G06710.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 50.8 bits (120), Expect = 5.1e-07 Identity = 21/42 (50.00%), Postives = 31/42 (73.81%), Query Frame = 0
BLAST of CsGy3G028460 vs. TAIR 10
Match: AT1G63330.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 49.7 bits (117), Expect = 1.1e-06 Identity = 25/67 (37.31%), Postives = 40/67 (59.70%), Query Frame = 0
BLAST of CsGy3G028460 vs. TAIR 10
Match: AT1G62590.1 (pentatricopeptide (PPR) repeat-containing protein ) HSP 1 Score: 49.7 bits (117), Expect = 1.1e-06 Identity = 25/67 (37.31%), Postives = 40/67 (59.70%), Query Frame = 0
BLAST of CsGy3G028460 vs. TAIR 10
Match: AT3G16710.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 49.7 bits (117), Expect = 1.1e-06 Identity = 24/67 (35.82%), Postives = 39/67 (58.21%), Query Frame = 0
BLAST of CsGy3G028460 vs. TAIR 10
Match: AT5G55840.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 49.7 bits (117), Expect = 1.1e-06 Identity = 21/39 (53.85%), Postives = 29/39 (74.36%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Gy14) v2.1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|