CsGy2G022090 (gene) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCAGTGTAGCAATCTCTCTTTTGGGGCTGAGTTCGTGTGCAGGGAACTTGGCTGCTAGTTTTATAATGACAACGGTTGATAATTTCAGTAAAACAATAGGAGTAAAGAGTTGGGTTTCAAGTAATATCAATGAGGGCCACAATGACTATTATTATTGGTTGCTTTTTGGTTTACTGGTTGCCAACTTTTTCTATTATCTGGCATGTAACAACTCTTATGGTCCTTCCAAGGAAGAATCAGAAGGTAGATCTAATGCTGAAGATAATAACAAGACTGTAAATTAG ATGTCCAGTGTAGCAATCTCTCTTTTGGGGCTGAGTTCGTGTGCAGGGAACTTGGCTGCTAGTTTTATAATGACAACGGTTGATAATTTCAGTAAAACAATAGGAGTAAAGAGTTGGGTTTCAAGTAATATCAATGAGGGCCACAATGACTATTATTATTGGTTGCTTTTTGGTTTACTGGTTGCCAACTTTTTCTATTATCTGGCATGTAACAACTCTTATGGTCCTTCCAAGGAAGAATCAGAAGGTAGATCTAATGCTGAAGATAATAACAAGACTGTAAATTAG ATGTCCAGTGTAGCAATCTCTCTTTTGGGGCTGAGTTCGTGTGCAGGGAACTTGGCTGCTAGTTTTATAATGACAACGGTTGATAATTTCAGTAAAACAATAGGAGTAAAGAGTTGGGTTTCAAGTAATATCAATGAGGGCCACAATGACTATTATTATTGGTTGCTTTTTGGTTTACTGGTTGCCAACTTTTTCTATTATCTGGCATGTAACAACTCTTATGGTCCTTCCAAGGAAGAATCAGAAGGTAGATCTAATGCTGAAGATAATAACAAGACTGTAAATTAG MSSVAISLLGLSSCAGNLAASFIMTTVDNFSKTIGVKSWVSSNINEGHNDYYYWLLFGLLVANFFYYLACNNSYGPSKEESEGRSNAEDNNKTVN* Homology
BLAST of CsGy2G022090 vs. ExPASy Swiss-Prot
Match: Q8LPL2 (Protein NRT1/ PTR FAMILY 1.1 OS=Arabidopsis thaliana OX=3702 GN=NPF1.1 PE=1 SV=2) HSP 1 Score: 75.1 bits (183), Expect = 4.8e-13 Identity = 39/80 (48.75%), Postives = 50/80 (62.50%), Query Frame = 0
BLAST of CsGy2G022090 vs. ExPASy Swiss-Prot
Match: Q9M817 (Protein NRT1/ PTR FAMILY 1.2 OS=Arabidopsis thaliana OX=3702 GN=NPF1.2 PE=1 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.1e-12 Identity = 38/87 (43.68%), Postives = 53/87 (60.92%), Query Frame = 0
BLAST of CsGy2G022090 vs. ExPASy Swiss-Prot
Match: Q9LYD5 (Protein NRT1/ PTR FAMILY 1.3 OS=Arabidopsis thaliana OX=3702 GN=NPF1.3 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 7.7e-11 Identity = 38/75 (50.67%), Postives = 50/75 (66.67%), Query Frame = 0
BLAST of CsGy2G022090 vs. ExPASy Swiss-Prot
Match: P46032 (Protein NRT1/ PTR FAMILY 8.3 OS=Arabidopsis thaliana OX=3702 GN=NPF8.3 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 4.0e-07 Identity = 30/81 (37.04%), Postives = 43/81 (53.09%), Query Frame = 0
BLAST of CsGy2G022090 vs. ExPASy Swiss-Prot
Match: Q9LFB8 (Protein NRT1/ PTR FAMILY 8.2 OS=Arabidopsis thaliana OX=3702 GN=NPF8.2 PE=2 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 2.0e-06 Identity = 26/63 (41.27%), Postives = 40/63 (63.49%), Query Frame = 0
BLAST of CsGy2G022090 vs. NCBI nr
Match: XP_011649735.2 (protein NRT1/ PTR FAMILY 1.2 [Cucumis sativus] >KAE8652164.1 hypothetical protein Csa_021897 [Cucumis sativus]) HSP 1 Score: 172 bits (437), Expect = 1.12e-48 Identity = 88/95 (92.63%), Postives = 90/95 (94.74%), Query Frame = 0
BLAST of CsGy2G022090 vs. NCBI nr
Match: XP_016899946.1 (PREDICTED: protein NRT1/ PTR FAMILY 1.2-like [Cucumis melo]) HSP 1 Score: 151 bits (382), Expect = 9.35e-41 Identity = 77/95 (81.05%), Postives = 83/95 (87.37%), Query Frame = 0
BLAST of CsGy2G022090 vs. NCBI nr
Match: KAE8652167.1 (hypothetical protein Csa_022021 [Cucumis sativus]) HSP 1 Score: 146 bits (369), Expect = 1.54e-39 Identity = 75/95 (78.95%), Postives = 81/95 (85.26%), Query Frame = 0
BLAST of CsGy2G022090 vs. NCBI nr
Match: XP_016900049.1 (PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X2 [Cucumis melo]) HSP 1 Score: 147 bits (370), Expect = 2.76e-39 Identity = 75/95 (78.95%), Postives = 81/95 (85.26%), Query Frame = 0
BLAST of CsGy2G022090 vs. NCBI nr
Match: XP_008445024.1 (PREDICTED: protein NRT1/ PTR FAMILY 1.2-like isoform X1 [Cucumis melo]) HSP 1 Score: 147 bits (370), Expect = 4.82e-39 Identity = 75/95 (78.95%), Postives = 81/95 (85.26%), Query Frame = 0
BLAST of CsGy2G022090 vs. ExPASy TrEMBL
Match: A0A0A0LP66 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G374660 PE=3 SV=1) HSP 1 Score: 187 bits (476), Expect = 3.85e-60 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 0
BLAST of CsGy2G022090 vs. ExPASy TrEMBL
Match: A0A0A0LPT0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G374640 PE=3 SV=1) HSP 1 Score: 175 bits (443), Expect = 7.33e-50 Identity = 90/95 (94.74%), Postives = 90/95 (94.74%), Query Frame = 0
BLAST of CsGy2G022090 vs. ExPASy TrEMBL
Match: A0A1S4DVD3 (protein NRT1/ PTR FAMILY 1.2-like OS=Cucumis melo OX=3656 GN=LOC103488191 PE=3 SV=1) HSP 1 Score: 151 bits (382), Expect = 4.53e-41 Identity = 77/95 (81.05%), Postives = 83/95 (87.37%), Query Frame = 0
BLAST of CsGy2G022090 vs. ExPASy TrEMBL
Match: A0A1S4DVN6 (protein NRT1/ PTR FAMILY 1.2-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103488189 PE=3 SV=1) HSP 1 Score: 147 bits (370), Expect = 1.33e-39 Identity = 75/95 (78.95%), Postives = 81/95 (85.26%), Query Frame = 0
BLAST of CsGy2G022090 vs. ExPASy TrEMBL
Match: A0A1S3BBQ7 (protein NRT1/ PTR FAMILY 1.2-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103488189 PE=3 SV=1) HSP 1 Score: 147 bits (370), Expect = 2.33e-39 Identity = 75/95 (78.95%), Postives = 81/95 (85.26%), Query Frame = 0
BLAST of CsGy2G022090 vs. TAIR 10
Match: AT3G16180.1 (Major facilitator superfamily protein ) HSP 1 Score: 75.1 bits (183), Expect = 3.4e-14 Identity = 39/80 (48.75%), Postives = 50/80 (62.50%), Query Frame = 0
BLAST of CsGy2G022090 vs. TAIR 10
Match: AT1G52190.1 (Major facilitator superfamily protein ) HSP 1 Score: 72.0 bits (175), Expect = 2.9e-13 Identity = 38/87 (43.68%), Postives = 53/87 (60.92%), Query Frame = 0
BLAST of CsGy2G022090 vs. TAIR 10
Match: AT5G11570.1 (Major facilitator superfamily protein ) HSP 1 Score: 67.8 bits (164), Expect = 5.5e-12 Identity = 38/75 (50.67%), Postives = 50/75 (66.67%), Query Frame = 0
BLAST of CsGy2G022090 vs. TAIR 10
Match: AT2G02040.1 (peptide transporter 2 ) HSP 1 Score: 55.5 bits (132), Expect = 2.8e-08 Identity = 30/81 (37.04%), Postives = 43/81 (53.09%), Query Frame = 0
BLAST of CsGy2G022090 vs. TAIR 10
Match: AT5G01180.1 (peptide transporter 5 ) HSP 1 Score: 53.1 bits (126), Expect = 1.4e-07 Identity = 26/63 (41.27%), Postives = 40/63 (63.49%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Gy14) v2.1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|