CsGy1G019078 (gene) Cucumber (Gy14) v2.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGATTGCAATGCCACAAAGTACCTGATGGAACCCAAGGCACAACTTCACAAAGACATGGAAGGAGCATCAATTGATGCTACAGAGTACAGAAGCATCGTTGGTTGTCTTAGATACTTACTGAAGACAAGGCCAGATCTTTCATATGTTGTTGGGATGGCGAGTAGGTATATGGAAAGGCCTACAACCATGCATTACAAGGTGGTCAAGCAAATACTTAG ATGGTTGATTGCAATGCCACAAAGTACCTGATGGAACCCAAGGCACAACTTCACAAAGACATGGAAGGAGCATCAATTGATGCTACAGAGTACAGAAGCATCGTTGGTTGTCTTAGATACTTACTGAAGACAAGGCCAGATCTTTCATATGTTGTTGGGATGGCGAGTAGGTATATGGAAAGGCCTACAACCATGCATTACAAGGTGGTCAAGCAAATACTTAG ATGGTTGATTGCAATGCCACAAAGTACCTGATGGAACCCAAGGCACAACTTCACAAAGACATGGAAGGAGCATCAATTGATGCTACAGAGTACAGAAGCATCGTTGGTTGTCTTAGATACTTACTGAAGACAAGGCCAGATCTTTCATATGTTGTTGGGATGGCGAGTAGGTATATGGAAAGGCCTACAACCATGCATTACAAGGTGGTCAAGCAAATACTTAG MVDCNATKYLMEPKAQLHKDMEGASIDATEYRSIVGCLRYLLKTRPDLSYVVGMASRYMERPTTMHYKVVKQILX Homology
BLAST of CsGy1G019078 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.9e-09 Identity = 34/70 (48.57%), Postives = 41/70 (58.57%), Query Frame = 0
BLAST of CsGy1G019078 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.8e-07 Identity = 26/48 (54.17%), Postives = 33/48 (68.75%), Query Frame = 0
BLAST of CsGy1G019078 vs. ExPASy Swiss-Prot
Match: P92519 (Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana OX=3702 GN=AtMg00810 PE=4 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.7e-05 Identity = 21/48 (43.75%), Postives = 33/48 (68.75%), Query Frame = 0
BLAST of CsGy1G019078 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 5.5e-04 Identity = 22/54 (40.74%), Postives = 34/54 (62.96%), Query Frame = 0
BLAST of CsGy1G019078 vs. NCBI nr
Match: KAE8653115.1 (hypothetical protein Csa_019554, partial [Cucumis sativus]) HSP 1 Score: 147 bits (371), Expect = 1.86e-44 Identity = 71/74 (95.95%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of CsGy1G019078 vs. NCBI nr
Match: KAE8648097.1 (hypothetical protein Csa_004708 [Cucumis sativus]) HSP 1 Score: 148 bits (373), Expect = 7.28e-44 Identity = 71/74 (95.95%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of CsGy1G019078 vs. NCBI nr
Match: KAE8648103.1 (hypothetical protein Csa_004691, partial [Cucumis sativus]) HSP 1 Score: 145 bits (366), Expect = 1.08e-43 Identity = 70/74 (94.59%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of CsGy1G019078 vs. NCBI nr
Match: KAE8652919.1 (hypothetical protein Csa_004527, partial [Cucumis sativus]) HSP 1 Score: 141 bits (356), Expect = 3.63e-42 Identity = 68/74 (91.89%), Postives = 68/74 (91.89%), Query Frame = 0
BLAST of CsGy1G019078 vs. NCBI nr
Match: KAE8646020.1 (hypothetical protein Csa_015698 [Cucumis sativus]) HSP 1 Score: 141 bits (356), Expect = 4.57e-42 Identity = 68/74 (91.89%), Postives = 68/74 (91.89%), Query Frame = 0
BLAST of CsGy1G019078 vs. ExPASy TrEMBL
Match: Q7XMW3 (OSJNBb0040D15.11 protein OS=Oryza sativa subsp. japonica OX=39947 GN=OSJNBb0040D15.11 PE=4 SV=2) HSP 1 Score: 111 bits (278), Expect = 9.86e-28 Identity = 48/74 (64.86%), Postives = 62/74 (83.78%), Query Frame = 0
BLAST of CsGy1G019078 vs. ExPASy TrEMBL
Match: A0A0A9FJ50 (Reverse transcriptase Ty1/copia-type domain-containing protein OS=Arundo donax OX=35708 PE=4 SV=1) HSP 1 Score: 111 bits (277), Expect = 1.16e-27 Identity = 52/74 (70.27%), Postives = 61/74 (82.43%), Query Frame = 0
BLAST of CsGy1G019078 vs. ExPASy TrEMBL
Match: A0A5K0VEQ6 (Reverse transcriptase Ty1/copia-type domain-containing protein (Fragment) OS=Nymphaea colorata OX=210225 GN=NYM_LOCUS1129 PE=4 SV=1) HSP 1 Score: 112 bits (280), Expect = 1.64e-27 Identity = 51/74 (68.92%), Postives = 60/74 (81.08%), Query Frame = 0
BLAST of CsGy1G019078 vs. ExPASy TrEMBL
Match: Q0J8A6 (Os08g0125300 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0125300 PE=2 SV=1) HSP 1 Score: 110 bits (274), Expect = 3.23e-26 Identity = 51/74 (68.92%), Postives = 58/74 (78.38%), Query Frame = 0
BLAST of CsGy1G019078 vs. ExPASy TrEMBL
Match: B8BDZ6 (Uncharacterized protein OS=Oryza sativa subsp. indica OX=39946 GN=OsI_30754 PE=4 SV=1) HSP 1 Score: 110 bits (274), Expect = 3.23e-26 Identity = 51/74 (68.92%), Postives = 58/74 (78.38%), Query Frame = 0
BLAST of CsGy1G019078 vs. TAIR 10
Match: ATMG00810.1 (DNA/RNA polymerases superfamily protein ) HSP 1 Score: 49.7 bits (117), Expect = 1.2e-06 Identity = 21/48 (43.75%), Postives = 33/48 (68.75%), Query Frame = 0
BLAST of CsGy1G019078 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 49.3 bits (116), Expect = 1.6e-06 Identity = 24/74 (32.43%), Postives = 37/74 (50.00%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|