Cp4.1LG19g04660 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCCTCTTTTGGAGGTCAAGTGCCGGTTGATCCAAATGACCCACATGTGCGAGATATTGGAAAATGGGCAGTGAACGAACACAACATACAAAGTGGGGATTCACTAAAGTTTCTTGAAGTGGTAAGTGGGTCGAAGCAAATAGTGTCTGGAGAGATGTACGAGCTTGTGTTGTTGGTTGATGTTGGTGGAAATCGTCAAGGAAAATATGAGGCTAAGGTGTGGGAGCAACCATGGGTGGTGCCTCCTCGGAAGCTCGAGTCTTTCCACGTTCTTCTCCAGGAGTGA ATGAGTTCCTCTTTTGGAGGTCAAGTGCCGGTTGATCCAAATGACCCACATGTGCGAGATATTGGAAAATGGGCAGTGAACGAACACAACATACAAAGTGGGGATTCACTAAAGTTTCTTGAAGTGGTAAGTGGGTCGAAGCAAATAGTGTCTGGAGAGATGTACGAGCTTGTGTTGTTGGTTGATGTTGGTGGAAATCGTCAAGGAAAATATGAGGCTAAGGTGTGGGAGCAACCATGGGTGGTGCCTCCTCGGAAGCTCGAGTCTTTCCACGTTCTTCTCCAGGAGTGA ATGAGTTCCTCTTTTGGAGGTCAAGTGCCGGTTGATCCAAATGACCCACATGTGCGAGATATTGGAAAATGGGCAGTGAACGAACACAACATACAAAGTGGGGATTCACTAAAGTTTCTTGAAGTGGTAAGTGGGTCGAAGCAAATAGTGTCTGGAGAGATGTACGAGCTTGTGTTGTTGGTTGATGTTGGTGGAAATCGTCAAGGAAAATATGAGGCTAAGGTGTGGGAGCAACCATGGGTGGTGCCTCCTCGGAAGCTCGAGTCTTTCCACGTTCTTCTCCAGGAGTGA MSSSFGGQVPVDPNDPHVRDIGKWAVNEHNIQSGDSLKFLEVVSGSKQIVSGEMYELVLLVDVGGNRQGKYEAKVWEQPWVVPPRKLESFHVLLQE Homology
BLAST of Cp4.1LG19g04660 vs. ExPASy Swiss-Prot
Match: Q10Q47 (Putative cysteine proteinase inhibitor 7 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210100 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.2e-11 Identity = 39/91 (42.86%), Postives = 54/91 (59.34%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.3e-10 Identity = 36/86 (41.86%), Postives = 47/86 (54.65%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. ExPASy Swiss-Prot
Match: Q84WT8 (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 64.3 bits (155), Expect = 8.5e-10 Identity = 35/89 (39.33%), Postives = 54/89 (60.67%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 63.5 bits (153), Expect = 1.5e-09 Identity = 37/86 (43.02%), Postives = 51/86 (59.30%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. ExPASy Swiss-Prot
Match: P09229 (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 62.8 bits (151), Expect = 2.5e-09 Identity = 32/77 (41.56%), Postives = 51/77 (66.23%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. NCBI nr
Match: KAG6595134.1 (Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 180 bits (457), Expect = 6.50e-57 Identity = 85/96 (88.54%), Postives = 90/96 (93.75%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. NCBI nr
Match: KAG6595136.1 (Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 172 bits (436), Expect = 1.04e-53 Identity = 83/96 (86.46%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. NCBI nr
Match: KAG6595135.1 (Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 168 bits (426), Expect = 3.48e-52 Identity = 81/96 (84.38%), Postives = 86/96 (89.58%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. NCBI nr
Match: XP_022963129.1 (cysteine proteinase inhibitor 8-like [Cucurbita moschata]) HSP 1 Score: 162 bits (410), Expect = 9.61e-50 Identity = 79/96 (82.29%), Postives = 83/96 (86.46%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. NCBI nr
Match: KAG6595137.1 (Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 85.9 bits (211), Expect = 2.24e-19 Identity = 43/75 (57.33%), Postives = 49/75 (65.33%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. ExPASy TrEMBL
Match: A0A6J1HJ77 (cysteine proteinase inhibitor 8-like OS=Cucurbita moschata OX=3662 GN=LOC111463428 PE=4 SV=1) HSP 1 Score: 162 bits (410), Expect = 4.65e-50 Identity = 79/96 (82.29%), Postives = 83/96 (86.46%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. ExPASy TrEMBL
Match: A0A368PY86 (Cystatin domain-containing protein OS=Setaria italica OX=4555 GN=SETIT_2G116300v2 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 2.71e-17 Identity = 40/85 (47.06%), Postives = 55/85 (64.71%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. ExPASy TrEMBL
Match: A5B2E1 (Cystatin domain-containing protein OS=Vitis vinifera OX=29760 GN=VITISV_013491 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 6.42e-17 Identity = 44/86 (51.16%), Postives = 59/86 (68.60%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. ExPASy TrEMBL
Match: F6HRK8 (Cystatin domain-containing protein OS=Vitis vinifera OX=29760 GN=VIT_00s0187g00040 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 6.42e-17 Identity = 44/86 (51.16%), Postives = 59/86 (68.60%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. ExPASy TrEMBL
Match: A0A6J1CMN4 (cysteine proteinase inhibitor 5-like OS=Momordica charantia OX=3673 GN=LOC111012543 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 8.08e-17 Identity = 42/86 (48.84%), Postives = 55/86 (63.95%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 64.3 bits (155), Expect = 6.1e-11 Identity = 35/89 (39.33%), Postives = 54/89 (60.67%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 63.5 bits (153), Expect = 1.0e-10 Identity = 37/86 (43.02%), Postives = 51/86 (59.30%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 60.5 bits (145), Expect = 8.8e-10 Identity = 28/75 (37.33%), Postives = 45/75 (60.00%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 60.5 bits (145), Expect = 8.8e-10 Identity = 28/75 (37.33%), Postives = 45/75 (60.00%), Query Frame = 0
BLAST of Cp4.1LG19g04660 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 54.7 bits (130), Expect = 4.8e-08 Identity = 24/68 (35.29%), Postives = 40/68 (58.82%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|