Cp4.1LG19g04630 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTCCGTTCCTGGAGGTCCAGTGCCGGTTGATCCAAATGACCCACACGTGCGAGATATTGGAGAATGGGCAGTGAAGGAACACAACAAACAAAGTGGGGATTCACTCAAGTTTCTTGAAGTGGTAAGTGGGTCGAAGCAAATAGTGTCTGGAGTGTTGTACAAGCTTGTGTTGTTGGTTGATGTTGGTGCAAATCATCATCGAAAATATGAGGCTAAGGTGTGGGAGCAACCATGGGTGAAGCCTCCTCGGAAGCTCGAGTCTTTCCACGTTCTTCTCCAGGAGTGA ATGAGTTCCGTTCCTGGAGGTCCAGTGCCGGTTGATCCAAATGACCCACACGTGCGAGATATTGGAGAATGGGCAGTGAAGGAACACAACAAACAAAGTGGGGATTCACTCAAGTTTCTTGAAGTGGTAAGTGGGTCGAAGCAAATAGTGTCTGGAGTGTTGTACAAGCTTGTGTTGTTGGTTGATGTTGGTGCAAATCATCATCGAAAATATGAGGCTAAGGTGTGGGAGCAACCATGGGTGAAGCCTCCTCGGAAGCTCGAGTCTTTCCACGTTCTTCTCCAGGAGTGA ATGAGTTCCGTTCCTGGAGGTCCAGTGCCGGTTGATCCAAATGACCCACACGTGCGAGATATTGGAGAATGGGCAGTGAAGGAACACAACAAACAAAGTGGGGATTCACTCAAGTTTCTTGAAGTGGTAAGTGGGTCGAAGCAAATAGTGTCTGGAGTGTTGTACAAGCTTGTGTTGTTGGTTGATGTTGGTGCAAATCATCATCGAAAATATGAGGCTAAGGTGTGGGAGCAACCATGGGTGAAGCCTCCTCGGAAGCTCGAGTCTTTCCACGTTCTTCTCCAGGAGTGA MSSVPGGPVPVDPNDPHVRDIGEWAVKEHNKQSGDSLKFLEVVSGSKQIVSGVLYKLVLLVDVGANHHRKYEAKVWEQPWVKPPRKLESFHVLLQE Homology
BLAST of Cp4.1LG19g04630 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 69.3 bits (168), Expect = 2.7e-11 Identity = 40/86 (46.51%), Postives = 54/86 (62.79%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. ExPASy Swiss-Prot
Match: Q10J94 (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 4.5e-11 Identity = 37/86 (43.02%), Postives = 51/86 (59.30%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. ExPASy Swiss-Prot
Match: P09229 (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 64.7 bits (156), Expect = 6.5e-10 Identity = 35/79 (44.30%), Postives = 52/79 (65.82%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. ExPASy Swiss-Prot
Match: Q10Q47 (Putative cysteine proteinase inhibitor 7 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210100 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 6.5e-10 Identity = 36/82 (43.90%), Postives = 47/82 (57.32%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.1e-09 Identity = 37/86 (43.02%), Postives = 53/86 (61.63%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. NCBI nr
Match: XP_022963129.1 (cysteine proteinase inhibitor 8-like [Cucurbita moschata]) HSP 1 Score: 192 bits (489), Expect = 8.51e-62 Identity = 92/96 (95.83%), Postives = 94/96 (97.92%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. NCBI nr
Match: KAG6595135.1 (Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 190 bits (483), Expect = 7.01e-61 Identity = 91/96 (94.79%), Postives = 94/96 (97.92%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. NCBI nr
Match: KAG6595136.1 (Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 190 bits (482), Expect = 9.95e-61 Identity = 91/96 (94.79%), Postives = 93/96 (96.88%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. NCBI nr
Match: KAG6595134.1 (Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 181 bits (458), Expect = 4.57e-57 Identity = 86/96 (89.58%), Postives = 91/96 (94.79%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. NCBI nr
Match: KAG6595137.1 (Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 92.8 bits (229), Expect = 4.14e-22 Identity = 44/76 (57.89%), Postives = 54/76 (71.05%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. ExPASy TrEMBL
Match: A0A6J1HJ77 (cysteine proteinase inhibitor 8-like OS=Cucurbita moschata OX=3662 GN=LOC111463428 PE=4 SV=1) HSP 1 Score: 192 bits (489), Expect = 4.12e-62 Identity = 92/96 (95.83%), Postives = 94/96 (97.92%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. ExPASy TrEMBL
Match: A0A0K9QH54 (Cystatin domain-containing protein OS=Spinacia oleracea OX=3562 GN=SOVF_186010 PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 7.67e-20 Identity = 45/96 (46.88%), Postives = 62/96 (64.58%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. ExPASy TrEMBL
Match: A0A368PY86 (Cystatin domain-containing protein OS=Setaria italica OX=4555 GN=SETIT_2G116300v2 PE=3 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 2.93e-19 Identity = 43/89 (48.31%), Postives = 59/89 (66.29%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. ExPASy TrEMBL
Match: A0A6J0L557 (cysteine proteinase inhibitor 5-like OS=Raphanus sativus OX=3726 GN=LOC108826438 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 7.30e-19 Identity = 40/84 (47.62%), Postives = 59/84 (70.24%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. ExPASy TrEMBL
Match: A0A2T7D577 (Cystatin domain-containing protein OS=Panicum hallii var. hallii OX=1504633 GN=GQ55_6G083700 PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.82e-18 Identity = 43/90 (47.78%), Postives = 61/90 (67.78%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 69.3 bits (168), Expect = 1.9e-12 Identity = 40/86 (46.51%), Postives = 54/86 (62.79%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 62.0 bits (149), Expect = 3.0e-10 Identity = 32/80 (40.00%), Postives = 49/80 (61.25%), Query Frame = 0
BLAST of Cp4.1LG19g04630 vs. TAIR 10
Match: AT5G05110.1 (Cystatin/monellin family protein ) HSP 1 Score: 55.1 bits (131), Expect = 3.7e-08 Identity = 26/64 (40.62%), Postives = 42/64 (65.62%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|