![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Cp4.1LG16g06230 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCGGTGTTTGGGTGTTCGACAAAAATGGCGTGGCCCGTTTAATATCGAACCCAACCAGGGAGTCGTTCGAGTGCAAGGACCCGCCCTATCCAGGGACCGCGACGGCGCCAGGGGCTCGGCCTAGAGTCCTGGTCTATCTCCCAACCAACCAAGTCATCCGCTCCTACGCCGAACTCGAGCAGCGACTGGGCGAACTCGGGTGGAGCCGGTACCGGAATTCAGCCGAACCGGAGCTCCTCCAATTCCACCGCTCCCATGACTCCGCCCACTTGATTTCCCTCCCCAAAAGCTTCGCCAAATTCAAGCCCATGCATATGTACGACATTGTCGTTAAAAATCGTCATTTCTTCGAAGTTCGTGACCCCAAATCATCGCACCCTTCTTAA ATGTCCGGTGTTTGGGTGTTCGACAAAAATGGCGTGGCCCGTTTAATATCGAACCCAACCAGGGAGTCGTTCGAGTGCAAGGACCCGCCCTATCCAGGGACCGCGACGGCGCCAGGGGCTCGGCCTAGAGTCCTGGTCTATCTCCCAACCAACCAAGTCATCCGCTCCTACGCCGAACTCGAGCAGCGACTGGGCGAACTCGGGTGGAGCCGGTACCGGAATTCAGCCGAACCGGAGCTCCTCCAATTCCACCGCTCCCATGACTCCGCCCACTTGATTTCCCTCCCCAAAAGCTTCGCCAAATTCAAGCCCATGCATATGTACGACATTGTCGTTAAAAATCGTCATTTCTTCGAAGTTCGTGACCCCAAATCATCGCACCCTTCTTAA ATGTCCGGTGTTTGGGTGTTCGACAAAAATGGCGTGGCCCGTTTAATATCGAACCCAACCAGGGAGTCGTTCGAGTGCAAGGACCCGCCCTATCCAGGGACCGCGACGGCGCCAGGGGCTCGGCCTAGAGTCCTGGTCTATCTCCCAACCAACCAAGTCATCCGCTCCTACGCCGAACTCGAGCAGCGACTGGGCGAACTCGGGTGGAGCCGGTACCGGAATTCAGCCGAACCGGAGCTCCTCCAATTCCACCGCTCCCATGACTCCGCCCACTTGATTTCCCTCCCCAAAAGCTTCGCCAAATTCAAGCCCATGCATATGTACGACATTGTCGTTAAAAATCGTCATTTCTTCGAAGTTCGTGACCCCAAATCATCGCACCCTTCTTAA MSGVWVFDKNGVARLISNPTRESFECKDPPYPGTATAPGARPRVLVYLPTNQVIRSYAELEQRLGELGWSRYRNSAEPELLQFHRSHDSAHLISLPKSFAKFKPMHMYDIVVKNRHFFEVRDPKSSHPS Homology
BLAST of Cp4.1LG16g06230 vs. ExPASy Swiss-Prot
Match: O24340 (Flowering-promoting factor 1 OS=Sinapis alba OX=3728 GN=FPF1 PE=2 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 7.4e-25 Identity = 62/122 (50.82%), Postives = 77/122 (63.11%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. ExPASy Swiss-Prot
Match: O23624 (Flowering-promoting factor 1 OS=Arabidopsis thaliana OX=3702 GN=FPF1 PE=1 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 9.7e-25 Identity = 60/122 (49.18%), Postives = 78/122 (63.93%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. ExPASy Swiss-Prot
Match: Q5Q0B3 (Flowering-promoting factor 1-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FLP1 PE=2 SV=2) HSP 1 Score: 111.7 bits (278), Expect = 6.3e-24 Identity = 60/124 (48.39%), Postives = 80/124 (64.52%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. ExPASy Swiss-Prot
Match: Q0E1D7 (Flowering-promoting factor 1-like protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0460200 PE=2 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 8.2e-24 Identity = 62/123 (50.41%), Postives = 82/123 (66.67%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. ExPASy Swiss-Prot
Match: Q9LXB5 (Flowering-promoting factor 1-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=FLP2 PE=2 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 5.3e-23 Identity = 60/122 (49.18%), Postives = 77/122 (63.11%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. NCBI nr
Match: KAG6570697.1 (Flowering-promoting factor 1, partial [Cucurbita argyrosperma subsp. sororia] >KAG7010544.1 Flowering-promoting factor 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 266 bits (681), Expect = 4.97e-90 Identity = 128/129 (99.22%), Postives = 129/129 (100.00%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. NCBI nr
Match: XP_022148408.1 (flowering-promoting factor 1-like [Momordica charantia]) HSP 1 Score: 231 bits (590), Expect = 4.16e-76 Identity = 117/131 (89.31%), Postives = 123/131 (93.89%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. NCBI nr
Match: OMO67780.1 (hypothetical protein CCACVL1_20321 [Corchorus capsularis]) HSP 1 Score: 213 bits (542), Expect = 6.89e-69 Identity = 101/123 (82.11%), Postives = 114/123 (92.68%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. NCBI nr
Match: KAG6760852.1 (hypothetical protein POTOM_034035 [Populus tomentosa]) HSP 1 Score: 213 bits (541), Expect = 1.01e-68 Identity = 101/126 (80.16%), Postives = 111/126 (88.10%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. NCBI nr
Match: KAG5238222.1 (flowering-promoting factor [Salix suchowensis]) HSP 1 Score: 212 bits (540), Expect = 1.44e-68 Identity = 101/126 (80.16%), Postives = 112/126 (88.89%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. ExPASy TrEMBL
Match: A0A0A0KE84 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G190350 PE=3 SV=1) HSP 1 Score: 246 bits (627), Expect = 4.44e-82 Identity = 119/129 (92.25%), Postives = 123/129 (95.35%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. ExPASy TrEMBL
Match: A0A6J1D405 (flowering-promoting factor 1-like OS=Momordica charantia OX=3673 GN=LOC111017063 PE=3 SV=1) HSP 1 Score: 231 bits (590), Expect = 2.02e-76 Identity = 117/131 (89.31%), Postives = 123/131 (93.89%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. ExPASy TrEMBL
Match: A0A1R3HBS3 (Uncharacterized protein OS=Corchorus capsularis OX=210143 GN=CCACVL1_20321 PE=3 SV=1) HSP 1 Score: 213 bits (542), Expect = 3.34e-69 Identity = 101/123 (82.11%), Postives = 114/123 (92.68%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. ExPASy TrEMBL
Match: A0A1Q3CDF3 (Uncharacterized protein OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_21732 PE=3 SV=1) HSP 1 Score: 212 bits (539), Expect = 9.88e-69 Identity = 102/126 (80.95%), Postives = 113/126 (89.68%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. ExPASy TrEMBL
Match: M5WHZ4 (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_6G075900 PE=3 SV=1) HSP 1 Score: 211 bits (536), Expect = 2.83e-68 Identity = 102/123 (82.93%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. TAIR 10
Match: AT5G24860.1 (flowering promoting factor 1 ) HSP 1 Score: 114.4 bits (285), Expect = 6.9e-26 Identity = 60/122 (49.18%), Postives = 78/122 (63.93%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. TAIR 10
Match: AT4G31380.1 (FPF1-like protein 1 ) HSP 1 Score: 111.7 bits (278), Expect = 4.4e-25 Identity = 60/124 (48.39%), Postives = 80/124 (64.52%), Query Frame = 0
BLAST of Cp4.1LG16g06230 vs. TAIR 10
Match: AT5G10625.1 (BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 108.6 bits (270), Expect = 3.8e-24 Identity = 60/122 (49.18%), Postives = 77/122 (63.11%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|