![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Cp4.1LG14g10680 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.CATTATAAGCTAAGTATTTCGATATAATCAACCAAAGCATTCAACAAGATGTCGGACATCTGTCCTCCCGGTAAGTTCTTCCTATCATATAAATCTCGATTTCAAAACCGTTCAATTGAACGAAGGATTTAGTTTATGATCTATAATGCATAAAAATTTGTCTCTTTCGTTTAAAATTGTTGTACAATGATTCTTCGGCCTAATTTACTTTATTATAATTTTGTCACCTCTCAAAAAAATTTAGATTTTTTCTATATATTAAAAGATTTGGCACGAAAAATGAGATTTTCAAAACTCTTATATTTATATTTGGGCAAATATCTTATTGGTTCGTTCATTTGCAGTAATTTGATTGTGAGTTATGTGCATTACAAAAAATTAACAGGAAAAAAGGAATGGCCAGAACTGGTGGGTATAGAATATTCTATCGCTGCTAGGATAATAGAAAGGGAGAATCCTCATGTCAAAGCACAAAAGATTATCGCGGGGAGTCCGAGAATTATGAATTACAATCCTGGACGAGTTTGGGTTGATGTCAATGTTGAGAATAAGTGTGTTTTAATTCCTAAAGCAGGTTAAGGGATGTAATATGATAAAATATATGAAATTACTAATAAAGTAGTGTGTGACTACCGTTTTAATTATTGAATTGTTCCAA CATTATAAGCTAAGTATTTCGATATAATCAACCAAAGCATTCAACAAGATGTCGGACATCTGTCCTCCCGGAAAAAAGGAATGGCCAGAACTGGTGGGTATAGAATATTCTATCGCTGCTAGGATAATAGAAAGGGAGAATCCTCATGTCAAAGCACAAAAGATTATCGCGGGGAGTCCGAGAATTATGAATTACAATCCTGGACGAGTTTGGGTTGATGTCAATGTTGAGAATAAGTGTGTTTTAATTCCTAAAGCAGGTTAAGGGATGTAATATGATAAAATATATGAAATTACTAATAAAGTAGTGTGTGACTACCGTTTTAATTATTGAATTGTTCCAA ATGTCGGACATCTGTCCTCCCGGAAAAAAGGAATGGCCAGAACTGGTGGGTATAGAATATTCTATCGCTGCTAGGATAATAGAAAGGGAGAATCCTCATGTCAAAGCACAAAAGATTATCGCGGGGAGTCCGAGAATTATGAATTACAATCCTGGACGAGTTTGGGTTGATGTCAATGTTGAGAATAAGTGTGTTTTAATTCCTAAAGCAGGTTAA MSDICPPGKKEWPELVGIEYSIAARIIERENPHVKAQKIIAGSPRIMNYNPGRVWVDVNVENKCVLIPKAG Homology
BLAST of Cp4.1LG14g10680 vs. ExPASy Swiss-Prot
Match: P19873 (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.0e-07 Identity = 28/65 (43.08%), Postives = 38/65 (58.46%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. ExPASy Swiss-Prot
Match: P82381 (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 3.2e-06 Identity = 26/62 (41.94%), Postives = 34/62 (54.84%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. ExPASy Swiss-Prot
Match: Q02214 (Trypsin inhibitor 1 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.2e-05 Identity = 27/69 (39.13%), Postives = 39/69 (56.52%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. ExPASy Swiss-Prot
Match: P80211 (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.6e-05 Identity = 28/63 (44.44%), Postives = 36/63 (57.14%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. ExPASy Swiss-Prot
Match: Q6XNP7 (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 49.7 bits (117), Expect = 1.6e-05 Identity = 29/61 (47.54%), Postives = 37/61 (60.66%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. NCBI nr
Match: KAA0049286.1 (Protease inhibitor protein [Cucumis melo var. makuwa] >TYK17272.1 Protease inhibitor protein [Cucumis melo var. makuwa]) HSP 1 Score: 89.4 bits (220), Expect = 1.59e-21 Identity = 41/63 (65.08%), Postives = 49/63 (77.78%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. NCBI nr
Match: KGN56897.1 (hypothetical protein Csa_010510 [Cucumis sativus]) HSP 1 Score: 89.0 bits (219), Expect = 2.25e-21 Identity = 41/71 (57.75%), Postives = 54/71 (76.06%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. NCBI nr
Match: KAA0049288.1 (Protease inhibitor protein [Cucumis melo var. makuwa] >TYK17270.1 Protease inhibitor protein [Cucumis melo var. makuwa]) HSP 1 Score: 86.7 bits (213), Expect = 1.01e-19 Identity = 41/67 (61.19%), Postives = 52/67 (77.61%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. NCBI nr
Match: KAE8650339.1 (hypothetical protein Csa_009729 [Cucumis sativus]) HSP 1 Score: 84.3 bits (207), Expect = 3.44e-18 Identity = 39/61 (63.93%), Postives = 48/61 (78.69%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. NCBI nr
Match: KAA0049287.1 (Protease inhibitor protein [Cucumis melo var. makuwa] >TYK17271.1 Protease inhibitor protein [Cucumis melo var. makuwa]) HSP 1 Score: 80.5 bits (197), Expect = 5.22e-18 Identity = 39/69 (56.52%), Postives = 48/69 (69.57%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. ExPASy TrEMBL
Match: A0A5A7U4U0 (Protease inhibitor protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001250 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 7.68e-22 Identity = 41/63 (65.08%), Postives = 49/63 (77.78%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. ExPASy TrEMBL
Match: A0A0A0L8E6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142910 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 1.09e-21 Identity = 41/71 (57.75%), Postives = 54/71 (76.06%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. ExPASy TrEMBL
Match: A0A0A0L9Z4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142410 PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 8.97e-21 Identity = 40/63 (63.49%), Postives = 49/63 (77.78%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. ExPASy TrEMBL
Match: A0A5A7U228 (Protease inhibitor protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001230 PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 4.89e-20 Identity = 41/67 (61.19%), Postives = 52/67 (77.61%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. ExPASy TrEMBL
Match: A0A5A7U4L9 (Protease inhibitor protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001240 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 2.53e-18 Identity = 39/69 (56.52%), Postives = 48/69 (69.57%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 55.5 bits (132), Expect = 2.1e-08 Identity = 32/71 (45.07%), Postives = 38/71 (53.52%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 51.6 bits (122), Expect = 3.0e-07 Identity = 31/72 (43.06%), Postives = 40/72 (55.56%), Query Frame = 0
BLAST of Cp4.1LG14g10680 vs. TAIR 10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 48.1 bits (113), Expect = 3.3e-06 Identity = 28/70 (40.00%), Postives = 36/70 (51.43%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|