![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Cp4.1LG13g10130 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGACGGAAGACAAGCGGAATATTCTTGACCATTATCGTCGACAGCTTGCTGCGAAGTTTGAGTTGAAACGGAAGCTTTACAAAGCCGTTTGCAACGATCCGAGTCTTCCCAACGATGTGCGTGAAGAGCATCGTTATAAGCTGTCGAAGCTGCCAAGAAATAGTTCGTTCACTCGACTGAGGAATCGCTGCATTTTCACCGGTCGGCCTAGGGGTGTCTACCAGCTTTTCCGTGTTTCTCGTATCGTTTTCCGTGATCTGGCGTCCAAAGGTCTTGTAATGGGCGTCAAGAAATCTTCCTGGTAG ATGACGGAAGACAAGCGGAATATTCTTGACCATTATCGTCGACAGCTTGCTGCGAAGTTTGAGTTGAAACGGAAGCTTTACAAAGCCGTTTGCAACGATCCGAGTCTTCCCAACGATGTGCGTGAAGAGCATCGTTATAAGCTGTCGAAGCTGCCAAGAAATAGTTCGTTCACTCGACTGAGGAATCGCTGCATTTTCACCGGTCGGCCTAGGGGTGTCTACCAGCTTTTCCGTGTTTCTCGTATCGTTTTCCGTGATCTGGCGTCCAAAGGTCTTGTAATGGGCGTCAAGAAATCTTCCTGGTAG ATGACGGAAGACAAGCGGAATATTCTTGACCATTATCGTCGACAGCTTGCTGCGAAGTTTGAGTTGAAACGGAAGCTTTACAAAGCCGTTTGCAACGATCCGAGTCTTCCCAACGATGTGCGTGAAGAGCATCGTTATAAGCTGTCGAAGCTGCCAAGAAATAGTTCGTTCACTCGACTGAGGAATCGCTGCATTTTCACCGGTCGGCCTAGGGGTGTCTACCAGCTTTTCCGTGTTTCTCGTATCGTTTTCCGTGATCTGGCGTCCAAAGGTCTTGTAATGGGCGTCAAGAAATCTTCCTGGTAG MTEDKRNILDHYRRQLAAKFELKRKLYKAVCNDPSLPNDVREEHRYKLSKLPRNSSFTRLRNRCIFTGRPRGVYQLFRVSRIVFRDLASKGLVMGVKKSSW Homology
BLAST of Cp4.1LG13g10130 vs. ExPASy Swiss-Prot
Match: P14875 (Ribosomal protein S14, mitochondrial OS=Oenothera berteroana OX=3950 GN=RPS14 PE=3 SV=2) HSP 1 Score: 157.9 bits (398), Expect = 6.0e-38 Identity = 73/98 (74.49%), Postives = 87/98 (88.78%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. ExPASy Swiss-Prot
Match: P05716 (Ribosomal protein S14, mitochondrial OS=Vicia faba OX=3906 GN=RPS14 PE=3 SV=2) HSP 1 Score: 151.4 bits (381), Expect = 5.6e-36 Identity = 72/98 (73.47%), Postives = 85/98 (86.73%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. ExPASy Swiss-Prot
Match: P49387 (Ribosomal protein S14, mitochondrial OS=Brassica napus OX=3708 GN=RPS14 PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 3.6e-35 Identity = 70/98 (71.43%), Postives = 83/98 (84.69%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. ExPASy Swiss-Prot
Match: P26873 (Ribosomal protein S14, mitochondrial OS=Marchantia polymorpha OX=3197 GN=RPS14 PE=3 SV=2) HSP 1 Score: 136.7 bits (343), Expect = 1.4e-31 Identity = 65/94 (69.15%), Postives = 78/94 (82.98%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. ExPASy Swiss-Prot
Match: P46752 (Ribosomal protein S14, mitochondrial OS=Prototheca wickerhamii OX=3111 GN=RPS14 PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 7.3e-20 Identity = 51/92 (55.43%), Postives = 65/92 (70.65%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. NCBI nr
Match: XP_023550870.1 (uncharacterized protein LOC111808878 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 202 bits (515), Expect = 1.32e-65 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. NCBI nr
Match: XP_022938933.1 (uncharacterized protein LOC111444996 [Cucurbita moschata] >XP_022938934.1 uncharacterized protein LOC111444996 [Cucurbita moschata] >KAG7016311.1 Ribosomal protein S14, mitochondrial, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 202 bits (514), Expect = 1.88e-65 Identity = 100/101 (99.01%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. NCBI nr
Match: KAG7032953.1 (Ribosomal protein S14, mitochondrial, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 201 bits (510), Expect = 7.66e-65 Identity = 99/101 (98.02%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. NCBI nr
Match: XP_038884392.1 (ribosomal protein S14, mitochondrial [Benincasa hispida]) HSP 1 Score: 196 bits (497), Expect = 7.37e-63 Identity = 95/101 (94.06%), Postives = 100/101 (99.01%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. NCBI nr
Match: XP_022134507.1 (uncharacterized protein LOC111006733 [Momordica charantia] >XP_022134508.1 uncharacterized protein LOC111006733 [Momordica charantia]) HSP 1 Score: 192 bits (489), Expect = 1.23e-61 Identity = 96/101 (95.05%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. ExPASy TrEMBL
Match: A0A6J1FKA4 (uncharacterized protein LOC111444996 OS=Cucurbita moschata OX=3662 GN=LOC111444996 PE=3 SV=1) HSP 1 Score: 202 bits (514), Expect = 9.09e-66 Identity = 100/101 (99.01%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. ExPASy TrEMBL
Match: A0A6J1C264 (uncharacterized protein LOC111006733 OS=Momordica charantia OX=3673 GN=LOC111006733 PE=3 SV=1) HSP 1 Score: 192 bits (489), Expect = 5.93e-62 Identity = 96/101 (95.05%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. ExPASy TrEMBL
Match: A0A5D3CKB3 (Ribosomal protein S14 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold304G00590 PE=3 SV=1) HSP 1 Score: 183 bits (464), Expect = 3.87e-58 Identity = 89/101 (88.12%), Postives = 97/101 (96.04%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. ExPASy TrEMBL
Match: A0A1S4E169 (ribosomal protein S14, mitochondrial OS=Cucumis melo OX=3656 GN=LOC103496488 PE=3 SV=1) HSP 1 Score: 183 bits (464), Expect = 3.87e-58 Identity = 89/101 (88.12%), Postives = 97/101 (96.04%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. ExPASy TrEMBL
Match: A0A0A0LSR8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G386130 PE=3 SV=1) HSP 1 Score: 180 bits (457), Expect = 4.52e-57 Identity = 88/101 (87.13%), Postives = 96/101 (95.05%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. TAIR 10
Match: AT2G34520.1 (mitochondrial ribosomal protein S14 ) HSP 1 Score: 146.7 bits (369), Expect = 9.8e-36 Identity = 69/97 (71.13%), Postives = 83/97 (85.57%), Query Frame = 0
BLAST of Cp4.1LG13g10130 vs. TAIR 10
Match: ATCG00330.1 (chloroplast ribosomal protein S14 ) HSP 1 Score: 53.9 bits (128), Expect = 8.6e-08 Identity = 34/90 (37.78%), Postives = 49/90 (54.44%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|