![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Cp4.1LG13g10050 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGGAAGAAAGAAGAAGGCTGTGCAGAAGGGAAGTACGCGACTCGTCGTCGGCTTGCAGTAGGAGATCAGCAACGACGTCGTTTAAGCAGAGATGCAGTTTACTGGTGAAAGAGCAGAGAGCTAGGTTTTACATTCTTCGCCGATGTGTCGTCATGCTCGTGTGTTGGAATTACTATGCTGACCCTTGA ATGATGGAAGAAAGAAGAAGGCTGTGCAGAAGGGAAGTACGCGACTCGTCGTCGGCTTGCAGTAGGAGATCAGCAACGACGTCGTTTAAGCAGAGATGCAGTTTACTGGTGAAAGAGCAGAGAGCTAGGTTTTACATTCTTCGCCGATGTGTCGTCATGCTCGTGTGTTGGAATTACTATGCTGACCCTTGA ATGATGGAAGAAAGAAGAAGGCTGTGCAGAAGGGAAGTACGCGACTCGTCGTCGGCTTGCAGTAGGAGATCAGCAACGACGTCGTTTAAGCAGAGATGCAGTTTACTGGTGAAAGAGCAGAGAGCTAGGTTTTACATTCTTCGCCGATGTGTCGTCATGCTCGTGTGTTGGAATTACTATGCTGACCCTTGA MMEERRRLCRREVRDSSSACSRRSATTSFKQRCSLLVKEQRARFYILRRCVVMLVCWNYYADP Homology
BLAST of Cp4.1LG13g10050 vs. ExPASy Swiss-Prot
Match: Q8S8S3 (Small polypeptide DEVIL 11 OS=Arabidopsis thaliana OX=3702 GN=DVL11 PE=3 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.5e-07 Identity = 28/57 (49.12%), Postives = 40/57 (70.18%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. ExPASy Swiss-Prot
Match: Q8L7D0 (Small polypeptide DEVIL 13 OS=Arabidopsis thaliana OX=3702 GN=DVL13 PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.3e-06 Identity = 30/57 (52.63%), Postives = 37/57 (64.91%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. ExPASy Swiss-Prot
Match: Q7XXN8 (Small polypeptide DEVIL 16 OS=Arabidopsis thaliana OX=3702 GN=DVL16 PE=2 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 4.9e-06 Identity = 21/31 (67.74%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. ExPASy Swiss-Prot
Match: Q6IM93 (Small polypeptide DEVIL 8 OS=Arabidopsis thaliana OX=3702 GN=DVL8 PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 6.4e-06 Identity = 22/43 (51.16%), Postives = 32/43 (74.42%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. ExPASy Swiss-Prot
Match: Q6IM82 (Small polypeptide DEVIL 19 OS=Arabidopsis thaliana OX=3702 GN=DVL19 PE=3 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 4.2e-05 Identity = 21/35 (60.00%), Postives = 24/35 (68.57%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. NCBI nr
Match: KAG7016303.1 (hypothetical protein SDJN02_21410, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 124 bits (310), Expect = 1.70e-35 Identity = 61/63 (96.83%), Postives = 61/63 (96.83%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. NCBI nr
Match: KAE8647306.1 (hypothetical protein Csa_004317 [Cucumis sativus]) HSP 1 Score: 106 bits (264), Expect = 1.65e-28 Identity = 54/63 (85.71%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. NCBI nr
Match: KAA0036490.1 (DVL-like protein [Cucumis melo var. makuwa] >TYJ99996.1 DVL-like protein [Cucumis melo var. makuwa]) HSP 1 Score: 105 bits (262), Expect = 3.33e-28 Identity = 54/63 (85.71%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. NCBI nr
Match: DAD28534.1 (TPA_asm: hypothetical protein HUJ06_030002 [Nelumbo nucifera]) HSP 1 Score: 68.6 bits (166), Expect = 1.28e-13 Identity = 36/51 (70.59%), Postives = 37/51 (72.55%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. NCBI nr
Match: DAD26787.1 (TPA_asm: hypothetical protein HUJ06_028255 [Nelumbo nucifera]) HSP 1 Score: 68.2 bits (165), Expect = 1.82e-13 Identity = 35/49 (71.43%), Postives = 37/49 (75.51%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. ExPASy TrEMBL
Match: A0A5A7SZH0 (DVL-like protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold360G00410 PE=4 SV=1) HSP 1 Score: 105 bits (262), Expect = 1.61e-28 Identity = 54/63 (85.71%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. ExPASy TrEMBL
Match: A0A2C9V3J5 (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_10G049900 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 2.53e-13 Identity = 34/62 (54.84%), Postives = 39/62 (62.90%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. ExPASy TrEMBL
Match: B9HLH7 (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_008G035900 PE=4 SV=2) HSP 1 Score: 64.3 bits (155), Expect = 2.96e-12 Identity = 34/63 (53.97%), Postives = 39/63 (61.90%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. ExPASy TrEMBL
Match: A0A3N7FP95 (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_010G226250 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 3.03e-12 Identity = 31/51 (60.78%), Postives = 38/51 (74.51%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. ExPASy TrEMBL
Match: A0A2P6SJ99 (Uncharacterized protein OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr1g0362751 PE=4 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 3.48e-12 Identity = 33/64 (51.56%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. TAIR 10
Match: AT2G39705.1 (ROTUNDIFOLIA like 8 ) HSP 1 Score: 56.2 bits (134), Expect = 1.1e-08 Identity = 28/57 (49.12%), Postives = 40/57 (70.18%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. TAIR 10
Match: AT2G29125.1 (ROTUNDIFOLIA like 2 ) HSP 1 Score: 53.1 bits (126), Expect = 9.2e-08 Identity = 30/57 (52.63%), Postives = 37/57 (64.91%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. TAIR 10
Match: AT2G36985.1 (DVL family protein ) HSP 1 Score: 51.2 bits (121), Expect = 3.5e-07 Identity = 21/31 (67.74%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. TAIR 10
Match: AT3G55515.1 (ROTUNDIFOLIA like 7 ) HSP 1 Score: 50.8 bits (120), Expect = 4.6e-07 Identity = 22/43 (51.16%), Postives = 32/43 (74.42%), Query Frame = 0
BLAST of Cp4.1LG13g10050 vs. TAIR 10
Match: AT1G53708.1 (ROTUNDIFOLIA like 9 ) HSP 1 Score: 48.1 bits (113), Expect = 3.0e-06 Identity = 21/35 (60.00%), Postives = 24/35 (68.57%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|