![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Cp4.1LG10g08470 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAAGACCGATGCGAGATCCGCTACGAATGGCAACGAATGTCTGACGCCGAGGAACTGCGCTTTTAGAATTCCGGCGGCATCCAAATGCCCGCCACCGCCGAAGAAGAAAGCGGTCACTGGTCGGAAGCAGCCTCCACCGACGAGCGGGTATTTCCACCCTCCCGATCTCGATGCTTTGTTTTCCATGCCGCCTTCATCACGATGGGAAGCTTGTGTTTAG ATGGAGAAGACCGATGCGAGATCCGCTACGAATGGCAACGAATGTCTGACGCCGAGGAACTGCGCTTTTAGAATTCCGGCGGCATCCAAATGCCCGCCACCGCCGAAGAAGAAAGCGGTCACTGGTCGGAAGCAGCCTCCACCGACGAGCGGGTATTTCCACCCTCCCGATCTCGATGCTTTGTTTTCCATGCCGCCTTCATCACGATGGGAAGCTTGTGTTTAG ATGGAGAAGACCGATGCGAGATCCGCTACGAATGGCAACGAATGTCTGACGCCGAGGAACTGCGCTTTTAGAATTCCGGCGGCATCCAAATGCCCGCCACCGCCGAAGAAGAAAGCGGTCACTGGTCGGAAGCAGCCTCCACCGACGAGCGGGTATTTCCACCCTCCCGATCTCGATGCTTTGTTTTCCATGCCGCCTTCATCACGATGGGAAGCTTGTGTTTAG MEKTDARSATNGNECLTPRNCAFRIPAASKCPPPPKKKAVTGRKQPPPTSGYFHPPDLDALFSMPPSSRWEACV Homology
BLAST of Cp4.1LG10g08470 vs. ExPASy Swiss-Prot
Match: Q1JPP8 (Cyclin-dependent protein kinase inhibitor SMR4 OS=Arabidopsis thaliana OX=3702 GN=SMR4 PE=1 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.8e-12 Identity = 36/73 (49.32%), Postives = 46/73 (63.01%), Query Frame = 0
BLAST of Cp4.1LG10g08470 vs. ExPASy Swiss-Prot
Match: Q9LNX4 (Cyclin-dependent protein kinase inhibitor SMR5 OS=Arabidopsis thaliana OX=3702 GN=SMR5 PE=1 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 2.6e-06 Identity = 27/58 (46.55%), Postives = 34/58 (58.62%), Query Frame = 0
BLAST of Cp4.1LG10g08470 vs. NCBI nr
Match: KAG6603646.1 (Cyclin-dependent protein kinase inhibitor SMR4, partial [Cucurbita argyrosperma subsp. sororia] >KAG7033830.1 Cyclin-dependent protein kinase inhibitor SMR4, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 162 bits (410), Expect = 1.99e-50 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of Cp4.1LG10g08470 vs. NCBI nr
Match: KAA0032664.1 (cyclin-dependent protein kinase inhibitor SMR2 [Cucumis melo var. makuwa] >TYK23544.1 cyclin-dependent protein kinase inhibitor SMR2 [Cucumis melo var. makuwa]) HSP 1 Score: 119 bits (299), Expect = 1.79e-33 Identity = 57/74 (77.03%), Postives = 61/74 (82.43%), Query Frame = 0
BLAST of Cp4.1LG10g08470 vs. NCBI nr
Match: KGN54563.2 (hypothetical protein Csa_017876 [Cucumis sativus]) HSP 1 Score: 113 bits (282), Expect = 8.54e-31 Identity = 53/72 (73.61%), Postives = 57/72 (79.17%), Query Frame = 0
BLAST of Cp4.1LG10g08470 vs. NCBI nr
Match: KAG7012399.1 (Cyclin-dependent protein kinase inhibitor SMR4, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 106 bits (264), Expect = 1.33e-27 Identity = 50/60 (83.33%), Postives = 53/60 (88.33%), Query Frame = 0
BLAST of Cp4.1LG10g08470 vs. NCBI nr
Match: KAF4373031.1 (hypothetical protein F8388_011058 [Cannabis sativa] >KAF4377526.1 hypothetical protein F8388_025017 [Cannabis sativa] >KAF4388576.1 hypothetical protein G4B88_021487 [Cannabis sativa]) HSP 1 Score: 82.0 bits (201), Expect = 1.45e-18 Identity = 37/74 (50.00%), Postives = 49/74 (66.22%), Query Frame = 0
BLAST of Cp4.1LG10g08470 vs. ExPASy TrEMBL
Match: A0A5A7SNA9 (Cyclin-dependent protein kinase inhibitor SMR2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold500G00480 PE=4 SV=1) HSP 1 Score: 119 bits (299), Expect = 8.65e-34 Identity = 57/74 (77.03%), Postives = 61/74 (82.43%), Query Frame = 0
BLAST of Cp4.1LG10g08470 vs. ExPASy TrEMBL
Match: A0A0A0KXI9 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G296170 PE=4 SV=1) HSP 1 Score: 117 bits (292), Expect = 1.01e-32 Identity = 54/74 (72.97%), Postives = 58/74 (78.38%), Query Frame = 0
BLAST of Cp4.1LG10g08470 vs. ExPASy TrEMBL
Match: A0A7J6H051 (Uncharacterized protein OS=Cannabis sativa OX=3483 GN=F8388_011058 PE=4 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 7.01e-19 Identity = 37/74 (50.00%), Postives = 49/74 (66.22%), Query Frame = 0
BLAST of Cp4.1LG10g08470 vs. ExPASy TrEMBL
Match: B9SZZ7 (Uncharacterized protein OS=Ricinus communis OX=3988 GN=RCOM_0452270 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 1.19e-17 Identity = 36/70 (51.43%), Postives = 44/70 (62.86%), Query Frame = 0
BLAST of Cp4.1LG10g08470 vs. ExPASy TrEMBL
Match: W9RWM9 (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_009438 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 1.93e-17 Identity = 36/64 (56.25%), Postives = 45/64 (70.31%), Query Frame = 0
BLAST of Cp4.1LG10g08470 vs. TAIR 10
Match: AT5G02220.1 (unknown protein; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 72.8 bits (177), Expect = 1.3e-13 Identity = 36/73 (49.32%), Postives = 46/73 (63.01%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|