![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Cp4.1LG06g00580 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCATTACCAAAATGCCACAGACGGCGGTGCTGAAGCAGATGATCAAGCGCTGCTCCAGCATGGGGAGAAAGCAGCACCACCACTACGACGACTTAGCAGGGCTCCCTTTGGACGTCCCCAAAGGACACTTCGTGGTGTACGTGGGTGAAAATCGAAGCAGATACATCGTCCCCATCACATTTCTGAATCATCCTCAGTTCCAAATCTTGCTCCAACAAGCCGCTGACGAATTTGGGTTCGATCATGACATGGGCCTCACCATTCCCTGCGACGAACACTCCTTTCAGTCCCTAACTTCCACGCTTAGATGA ATGGGCATTACCAAAATGCCACAGACGGCGGTGCTGAAGCAGATGATCAAGCGCTGCTCCAGCATGGGGAGAAAGCAGCACCACCACTACGACGACTTAGCAGGGCTCCCTTTGGACGTCCCCAAAGGACACTTCGTGGTGTACGTGGGTGAAAATCGAAGCAGATACATCGTCCCCATCACATTTCTGAATCATCCTCAGTTCCAAATCTTGCTCCAACAAGCCGCTGACGAATTTGGGTTCGATCATGACATGGGCCTCACCATTCCCTGCGACGAACACTCCTTTCAGTCCCTAACTTCCACGCTTAGATGA ATGGGCATTACCAAAATGCCACAGACGGCGGTGCTGAAGCAGATGATCAAGCGCTGCTCCAGCATGGGGAGAAAGCAGCACCACCACTACGACGACTTAGCAGGGCTCCCTTTGGACGTCCCCAAAGGACACTTCGTGGTGTACGTGGGTGAAAATCGAAGCAGATACATCGTCCCCATCACATTTCTGAATCATCCTCAGTTCCAAATCTTGCTCCAACAAGCCGCTGACGAATTTGGGTTCGATCATGACATGGGCCTCACCATTCCCTGCGACGAACACTCCTTTCAGTCCCTAACTTCCACGCTTAGATGA MGITKMPQTAVLKQMIKRCSSMGRKQHHHYDDLAGLPLDVPKGHFVVYVGENRSRYIVPITFLNHPQFQILLQQAADEFGFDHDMGLTIPCDEHSFQSLTSTLR Homology
BLAST of Cp4.1LG06g00580 vs. ExPASy Swiss-Prot
Match: O65695 (Auxin-responsive protein SAUR50 OS=Arabidopsis thaliana OX=3702 GN=SAUR50 PE=1 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 3.4e-36 Identity = 72/101 (71.29%), Postives = 86/101 (85.15%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. ExPASy Swiss-Prot
Match: Q9SL45 (Protein SMALL AUXIN UP-REGULATED RNA 10 OS=Arabidopsis thaliana OX=3702 GN=SAUR10 PE=2 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 7.5e-28 Identity = 60/100 (60.00%), Postives = 76/100 (76.00%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. ExPASy Swiss-Prot
Match: P0DKL1 (Auxin-responsive protein SAUR50 OS=Helianthus annuus OX=4232 PE=3 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 4.1e-26 Identity = 56/99 (56.57%), Postives = 72/99 (72.73%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. ExPASy Swiss-Prot
Match: P32295 (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata OX=3916 GN=ARG7 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 4.6e-17 Identity = 40/67 (59.70%), Postives = 49/67 (73.13%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. ExPASy Swiss-Prot
Match: P33081 (Auxin-induced protein 15A OS=Glycine max OX=3847 PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.7e-16 Identity = 38/66 (57.58%), Postives = 48/66 (72.73%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. NCBI nr
Match: XP_023535895.1 (auxin-responsive protein SAUR50-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 219 bits (559), Expect = 3.18e-72 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. NCBI nr
Match: XP_022937029.1 (auxin-responsive protein SAUR50-like [Cucurbita moschata] >XP_022975872.1 auxin-responsive protein SAUR50-like [Cucurbita maxima] >KAG6591277.1 Auxin-responsive protein SAUR50, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 216 bits (551), Expect = 5.29e-71 Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. NCBI nr
Match: KAG6608586.1 (Auxin-responsive protein SAUR50, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 182 bits (463), Expect = 1.46e-57 Identity = 91/107 (85.05%), Postives = 97/107 (90.65%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. NCBI nr
Match: XP_022941161.1 (auxin-responsive protein SAUR50-like [Cucurbita moschata] >XP_022980903.1 auxin-responsive protein SAUR50-like [Cucurbita maxima] >XP_023525369.1 auxin-responsive protein SAUR50-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 182 bits (462), Expect = 2.07e-57 Identity = 88/101 (87.13%), Postives = 94/101 (93.07%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. NCBI nr
Match: XP_027354820.1 (auxin-responsive protein SAUR50-like [Abrus precatorius]) HSP 1 Score: 163 bits (413), Expect = 6.33e-50 Identity = 76/100 (76.00%), Postives = 89/100 (89.00%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. ExPASy TrEMBL
Match: A0A6J1IE85 (auxin-responsive protein SAUR50-like OS=Cucurbita maxima OX=3661 GN=LOC111476445 PE=3 SV=1) HSP 1 Score: 216 bits (551), Expect = 2.56e-71 Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. ExPASy TrEMBL
Match: A0A6J1F9Z6 (auxin-responsive protein SAUR50-like OS=Cucurbita moschata OX=3662 GN=LOC111443449 PE=3 SV=1) HSP 1 Score: 216 bits (551), Expect = 2.56e-71 Identity = 103/104 (99.04%), Postives = 103/104 (99.04%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. ExPASy TrEMBL
Match: A0A6J1J0M7 (auxin-responsive protein SAUR50-like OS=Cucurbita maxima OX=3661 GN=LOC111480219 PE=3 SV=1) HSP 1 Score: 182 bits (462), Expect = 1.00e-57 Identity = 88/101 (87.13%), Postives = 94/101 (93.07%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. ExPASy TrEMBL
Match: A0A6J1FKC5 (auxin-responsive protein SAUR50-like OS=Cucurbita moschata OX=3662 GN=LOC111446542 PE=3 SV=1) HSP 1 Score: 182 bits (462), Expect = 1.00e-57 Identity = 88/101 (87.13%), Postives = 94/101 (93.07%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. ExPASy TrEMBL
Match: A0A172J216 (Small auxin up regulated protein OS=Boehmeria nivea OX=83906 GN=SAUR38 PE=2 SV=1) HSP 1 Score: 162 bits (410), Expect = 9.64e-50 Identity = 79/101 (78.22%), Postives = 88/101 (87.13%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. TAIR 10
Match: AT4G34760.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 152.1 bits (383), Expect = 2.4e-37 Identity = 72/101 (71.29%), Postives = 86/101 (85.15%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. TAIR 10
Match: AT1G75580.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 150.2 bits (378), Expect = 9.1e-37 Identity = 70/101 (69.31%), Postives = 87/101 (86.14%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. TAIR 10
Match: AT4G38860.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 141.4 bits (355), Expect = 4.2e-34 Identity = 70/102 (68.63%), Postives = 84/102 (82.35%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. TAIR 10
Match: AT1G19830.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 140.2 bits (352), Expect = 9.4e-34 Identity = 63/105 (60.00%), Postives = 85/105 (80.95%), Query Frame = 0
BLAST of Cp4.1LG06g00580 vs. TAIR 10
Match: AT2G21220.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 140.2 bits (352), Expect = 9.4e-34 Identity = 66/100 (66.00%), Postives = 83/100 (83.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|