
Cp4.1LG01g17610 (gene) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGTGGACTCAAACCCTTCCGATCATGGCCGCTTTCATGGCCATTTTCATTTTCCTCCTCACCCTAACCAACGCTCAAAACGCCCCCGGTGACTACCTCGCGCTTCACAACCAAGCTCGAGCCCAGGTTGGCGTCGGCCCCATGCAATGAAGCAACACTGTGGCCGTGTACGCTCAAGCCTATGCGGAAAAAAGAAAGGGTGACTGCGCCATGATTCACTCAACCGGGCCATACGGGGAAAACATAGCCGCGGGCTACTACCCTGAGTTCACTGGGGCAGATGCGGTGAAGTTGTGGGCGAACGAGAAGCCGCTGTATGATCATGCGTCAAATAAATGCGTGGGTGGTGAATGTGGGCACTACACTCAGATGGTGTGGCGGAGCTCGGTGTGGCTTGAATGTGCTACAGTGCCCTGCAAGGCTAATTCTCAATTTGTT ATGATCAACACTGTGGCCGTGTACGCTCAAGCCTATGCGGAAAAAAGAAAGGGTGACTGCGCCATGATTCACTCAACCGGGCCATACGGGGAAAACATAGCCGCGGGCTACTACCCTGAGTTCACTGGGGCAGATGCGGTGAAGTTGTGGGCGAACGAGAAGCCGCTGTATGATCATGCGTCAAATAAATGCGTGGGTGGTGAATGTGGGCACTACACTCAGATGGTGTGGCGGAGCTCGGTGTGGCTTGAATGTGCTACAGTGCCCTGCAAGGCTAATTCTCAATTTGTT ATGATCAACACTGTGGCCGTGTACGCTCAAGCCTATGCGGAAAAAAGAAAGGGTGACTGCGCCATGATTCACTCAACCGGGCCATACGGGGAAAACATAGCCGCGGGCTACTACCCTGAGTTCACTGGGGCAGATGCGGTGAAGTTGTGGGCGAACGAGAAGCCGCTGTATGATCATGCGTCAAATAAATGCGTGGGTGGTGAATGTGGGCACTACACTCAGATGGTGTGGCGGAGCTCGGTGTGGCTTGAATGTGCTACAGTGCCCTGCAAGGCTAATTCTCAATTTGTT MINTVAVYAQAYAEKRKGDCAMIHSTGPYGENIAAGYYPEFTGADAVKLWANEKPLYDHASNKCVGGECGHYTQMVWRSSVWLECATVPCKANSQFV Homology
BLAST of Cp4.1LG01g17610 vs. ExPASy Swiss-Prot
Match: P11670 (Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum OX=4097 PE=3 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.0e-26 Identity = 54/86 (62.79%), Postives = 64/86 (74.42%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. ExPASy Swiss-Prot
Match: Q08697 (Pathogenesis-related protein 1A1 OS=Solanum lycopersicum OX=4081 PE=2 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.8e-24 Identity = 52/94 (55.32%), Postives = 64/94 (68.09%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. ExPASy Swiss-Prot
Match: P07053 (Pathogenesis-related protein 1B OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.3e-21 Identity = 47/89 (52.81%), Postives = 58/89 (65.17%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. ExPASy Swiss-Prot
Match: P08299 (Pathogenesis-related protein 1A OS=Nicotiana tabacum OX=4097 PE=1 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.7e-21 Identity = 47/87 (54.02%), Postives = 58/87 (66.67%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. ExPASy Swiss-Prot
Match: P09042 (Pathogenesis-related protein 1C OS=Nicotiana tabacum OX=4097 PE=2 SV=3) HSP 1 Score: 102.8 bits (255), Expect = 2.2e-21 Identity = 48/94 (51.06%), Postives = 58/94 (61.70%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. NCBI nr
Match: XP_022958915.1 (basic form of pathogenesis-related protein 1-like [Cucurbita moschata]) HSP 1 Score: 199 bits (507), Expect = 3.42e-64 Identity = 91/95 (95.79%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. NCBI nr
Match: XP_022973608.1 (basic form of pathogenesis-related protein 1-like [Cucurbita maxima]) HSP 1 Score: 202 bits (513), Expect = 4.60e-64 Identity = 92/95 (96.84%), Postives = 92/95 (96.84%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. NCBI nr
Match: XP_022975701.1 (basic form of pathogenesis-related protein 1-like [Cucurbita maxima]) HSP 1 Score: 199 bits (507), Expect = 8.22e-64 Identity = 91/95 (95.79%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. NCBI nr
Match: XP_022930079.1 (basic form of pathogenesis-related protein 1-like [Cucurbita moschata] >XP_022930080.1 basic form of pathogenesis-related protein 1-like [Cucurbita moschata]) HSP 1 Score: 199 bits (507), Expect = 1.07e-63 Identity = 91/95 (95.79%), Postives = 92/95 (96.84%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. NCBI nr
Match: XP_022974675.1 (basic form of pathogenesis-related protein 1-like, partial [Cucurbita maxima]) HSP 1 Score: 199 bits (507), Expect = 1.53e-63 Identity = 91/95 (95.79%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. ExPASy TrEMBL
Match: A0A6J1H4T9 (basic form of pathogenesis-related protein 1-like OS=Cucurbita moschata OX=3662 GN=LOC111460061 PE=4 SV=1) HSP 1 Score: 199 bits (507), Expect = 1.65e-64 Identity = 91/95 (95.79%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. ExPASy TrEMBL
Match: A0A6J1IDM7 (basic form of pathogenesis-related protein 1-like OS=Cucurbita maxima OX=3661 GN=LOC111472192 PE=4 SV=1) HSP 1 Score: 202 bits (513), Expect = 2.23e-64 Identity = 92/95 (96.84%), Postives = 92/95 (96.84%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. ExPASy TrEMBL
Match: A0A6J1IEX8 (basic form of pathogenesis-related protein 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475711 PE=4 SV=1) HSP 1 Score: 199 bits (507), Expect = 3.98e-64 Identity = 91/95 (95.79%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. ExPASy TrEMBL
Match: A0A6J1EQL1 (basic form of pathogenesis-related protein 1-like OS=Cucurbita moschata OX=3662 GN=LOC111436565 PE=4 SV=1) HSP 1 Score: 199 bits (507), Expect = 5.16e-64 Identity = 91/95 (95.79%), Postives = 92/95 (96.84%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. ExPASy TrEMBL
Match: A0A6J1IEK2 (basic form of pathogenesis-related protein 1-like OS=Cucurbita maxima OX=3661 GN=LOC111473362 PE=4 SV=1) HSP 1 Score: 199 bits (507), Expect = 7.38e-64 Identity = 91/95 (95.79%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. TAIR 10
Match: AT1G50060.1 (CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein ) HSP 1 Score: 110.5 bits (275), Expect = 7.5e-25 Identity = 50/95 (52.63%), Postives = 61/95 (64.21%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. TAIR 10
Match: AT2G19990.1 (pathogenesis-related protein-1-like ) HSP 1 Score: 107.5 bits (267), Expect = 6.3e-24 Identity = 52/95 (54.74%), Postives = 66/95 (69.47%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. TAIR 10
Match: AT2G14610.1 (pathogenesis-related gene 1 ) HSP 1 Score: 102.4 bits (254), Expect = 2.0e-22 Identity = 47/86 (54.65%), Postives = 62/86 (72.09%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. TAIR 10
Match: AT3G19690.1 (CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein ) HSP 1 Score: 102.4 bits (254), Expect = 2.0e-22 Identity = 47/96 (48.96%), Postives = 62/96 (64.58%), Query Frame = 0
BLAST of Cp4.1LG01g17610 vs. TAIR 10
Match: AT1G50050.1 (CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein ) HSP 1 Score: 101.3 bits (251), Expect = 4.5e-22 Identity = 49/95 (51.58%), Postives = 60/95 (63.16%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|