![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CmoCh18G003710 (gene) Cucurbita moschata (Rifu) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACACTAAAGGTTGCTCACCTTCTGTTGTTACCTATACATCAATGATACATGGTTTGTGTGCAATTCAAGTACTTAAAGATATGATGGGCAAGGGTATTGCACCTAATGTATTTACTTACAGTACCCTAATGGATGGATTTTGCAAGGCTGGCCATTCTTTGCAAGCTAGTAGATTTCAAGAAGCTGCAAACTTCTTGGATGAGATGGTCATTTGA ATGGACACTAAAGGTTGCTCACCTTCTGTTGTTACCTATACATCAATGATACATGGTTTGTGTGCAATTCAAGTACTTAAAGATATGATGGGCAAGGGTATTGCACCTAATGTATTTACTTACAGTACCCTAATGGATGGATTTTGCAAGGCTGGCCATTCTTTGCAAGCTAGTAGATTTCAAGAAGCTGCAAACTTCTTGGATGAGATGGTCATTTGA ATGGACACTAAAGGTTGCTCACCTTCTGTTGTTACCTATACATCAATGATACATGGTTTGTGTGCAATTCAAGTACTTAAAGATATGATGGGCAAGGGTATTGCACCTAATGTATTTACTTACAGTACCCTAATGGATGGATTTTGCAAGGCTGGCCATTCTTTGCAAGCTAGTAGATTTCAAGAAGCTGCAAACTTCTTGGATGAGATGGTCATTTGA MDTKGCSPSVVTYTSMIHGLCAIQVLKDMMGKGIAPNVFTYSTLMDGFCKAGHSLQASRFQEAANFLDEMVI Homology
BLAST of CmoCh18G003710 vs. ExPASy Swiss-Prot
Match: Q9FNL2 (Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana OX=3702 GN=At5g46100 PE=2 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 4.3e-14 Identity = 39/69 (56.52%), Postives = 48/69 (69.57%), Query Frame = 0
BLAST of CmoCh18G003710 vs. ExPASy Swiss-Prot
Match: Q3ECK2 (Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g62680 PE=2 SV=2) HSP 1 Score: 62.4 bits (150), Expect = 2.4e-09 Identity = 31/69 (44.93%), Postives = 43/69 (62.32%), Query Frame = 0
BLAST of CmoCh18G003710 vs. ExPASy Swiss-Prot
Match: Q0WVK7 (Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g05670 PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 9.2e-09 Identity = 27/60 (45.00%), Postives = 43/60 (71.67%), Query Frame = 0
BLAST of CmoCh18G003710 vs. ExPASy Swiss-Prot
Match: Q9FIX3 (Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana OX=3702 GN=EMB2745 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.1e-08 Identity = 28/58 (48.28%), Postives = 41/58 (70.69%), Query Frame = 0
BLAST of CmoCh18G003710 vs. ExPASy Swiss-Prot
Match: Q9FMF6 (Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g64320 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.1e-08 Identity = 32/73 (43.84%), Postives = 42/73 (57.53%), Query Frame = 0
BLAST of CmoCh18G003710 vs. ExPASy TrEMBL
Match: A0A6J1CDW1 (pentatricopeptide repeat-containing protein At5g46100 isoform X1 OS=Momordica charantia OX=3673 GN=LOC111010648 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 3.9e-18 Identity = 47/64 (73.44%), Postives = 54/64 (84.38%), Query Frame = 0
BLAST of CmoCh18G003710 vs. ExPASy TrEMBL
Match: A0A6J1CF14 (pentatricopeptide repeat-containing protein At5g46100 isoform X2 OS=Momordica charantia OX=3673 GN=LOC111010648 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 3.9e-18 Identity = 47/64 (73.44%), Postives = 54/64 (84.38%), Query Frame = 0
BLAST of CmoCh18G003710 vs. ExPASy TrEMBL
Match: A0A6J1KLZ3 (pentatricopeptide repeat-containing protein At5g46100 OS=Cucurbita maxima OX=3661 GN=LOC111495767 PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 8.7e-18 Identity = 47/64 (73.44%), Postives = 53/64 (82.81%), Query Frame = 0
BLAST of CmoCh18G003710 vs. ExPASy TrEMBL
Match: A0A6J1EKD3 (pentatricopeptide repeat-containing protein At5g46100 OS=Cucurbita moschata OX=3662 GN=LOC111434127 PE=4 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 1.1e-17 Identity = 46/64 (71.88%), Postives = 53/64 (82.81%), Query Frame = 0
BLAST of CmoCh18G003710 vs. ExPASy TrEMBL
Match: A0A2N9FIY0 (Senescence domain-containing protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS14937 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 2.1e-16 Identity = 49/84 (58.33%), Postives = 58/84 (69.05%), Query Frame = 0
BLAST of CmoCh18G003710 vs. NCBI nr
Match: KAG7012455.1 (Pentatricopeptide repeat-containing protein, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 118.6 bits (296), Expect = 2.2e-23 Identity = 55/64 (85.94%), Postives = 59/64 (92.19%), Query Frame = 0
BLAST of CmoCh18G003710 vs. NCBI nr
Match: XP_022139832.1 (pentatricopeptide repeat-containing protein At5g46100 isoform X2 [Momordica charantia] >XP_022139834.1 pentatricopeptide repeat-containing protein At5g46100 isoform X2 [Momordica charantia]) HSP 1 Score: 100.1 bits (248), Expect = 8.0e-18 Identity = 47/64 (73.44%), Postives = 54/64 (84.38%), Query Frame = 0
BLAST of CmoCh18G003710 vs. NCBI nr
Match: XP_022139830.1 (pentatricopeptide repeat-containing protein At5g46100 isoform X1 [Momordica charantia] >XP_022139831.1 pentatricopeptide repeat-containing protein At5g46100 isoform X1 [Momordica charantia]) HSP 1 Score: 100.1 bits (248), Expect = 8.0e-18 Identity = 47/64 (73.44%), Postives = 54/64 (84.38%), Query Frame = 0
BLAST of CmoCh18G003710 vs. NCBI nr
Match: XP_023001715.1 (pentatricopeptide repeat-containing protein At5g46100 [Cucurbita maxima]) HSP 1 Score: 99.0 bits (245), Expect = 1.8e-17 Identity = 47/64 (73.44%), Postives = 53/64 (82.81%), Query Frame = 0
BLAST of CmoCh18G003710 vs. NCBI nr
Match: XP_022927208.1 (pentatricopeptide repeat-containing protein At5g46100 [Cucurbita moschata]) HSP 1 Score: 98.6 bits (244), Expect = 2.3e-17 Identity = 46/64 (71.88%), Postives = 53/64 (82.81%), Query Frame = 0
BLAST of CmoCh18G003710 vs. TAIR 10
Match: AT5G46100.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 78.2 bits (191), Expect = 3.0e-15 Identity = 39/69 (56.52%), Postives = 48/69 (69.57%), Query Frame = 0
BLAST of CmoCh18G003710 vs. TAIR 10
Match: AT1G62680.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 62.4 bits (150), Expect = 1.7e-10 Identity = 31/69 (44.93%), Postives = 43/69 (62.32%), Query Frame = 0
BLAST of CmoCh18G003710 vs. TAIR 10
Match: AT1G05670.1 (Pentatricopeptide repeat (PPR-like) superfamily protein ) HSP 1 Score: 60.5 bits (145), Expect = 6.6e-10 Identity = 27/60 (45.00%), Postives = 43/60 (71.67%), Query Frame = 0
BLAST of CmoCh18G003710 vs. TAIR 10
Match: AT1G05670.2 (Pentatricopeptide repeat (PPR-like) superfamily protein ) HSP 1 Score: 60.5 bits (145), Expect = 6.6e-10 Identity = 27/60 (45.00%), Postives = 43/60 (71.67%), Query Frame = 0
BLAST of CmoCh18G003710 vs. TAIR 10
Match: AT5G39710.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 59.3 bits (142), Expect = 1.5e-09 Identity = 28/58 (48.28%), Postives = 41/58 (70.69%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita moschata (Rifu) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|