![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
CmoCh14G011930 (gene) Cucurbita moschata (Rifu) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAGATTGTCAATTTCAAGTCTCTGTGTTTTGGTGGCGGCGGTGGCGACGATGGCGCTTCTCACTGGTGCTCCGGTGGCCGATGCGGTGGACTGCAACCCTTCGGAGCTCAGCCCATGTCTTCCTGCAATTACGTCATCGACACCGCCGACGAGCTCTTGTTGCCAGAAGATGGTTGAGCAGACGCCGTGCCTTTGCGGATACTTCAAGAATCCAGAATTCAAGCCTTACGTTACTGGCGGCAAACGGGTTGCTGCTGCTTGCGGCCTCACCGTTCCTGAGTGTTAG ATGAAGAGATTGTCAATTTCAAGTCTCTGTGTTTTGGTGGCGGCGGTGGCGACGATGGCGCTTCTCACTGGTGCTCCGGTGGCCGATGCGGTGGACTGCAACCCTTCGGAGCTCAGCCCATGTCTTCCTGCAATTACGTCATCGACACCGCCGACGAGCTCTTGTTGCCAGAAGATGGTTGAGCAGACGCCGTGCCTTTGCGGATACTTCAAGAATCCAGAATTCAAGCCTTACGTTACTGGCGGCAAACGGGTTGCTGCTGCTTGCGGCCTCACCGTTCCTGAGTGTTAG ATGAAGAGATTGTCAATTTCAAGTCTCTGTGTTTTGGTGGCGGCGGTGGCGACGATGGCGCTTCTCACTGGTGCTCCGGTGGCCGATGCGGTGGACTGCAACCCTTCGGAGCTCAGCCCATGTCTTCCTGCAATTACGTCATCGACACCGCCGACGAGCTCTTGTTGCCAGAAGATGGTTGAGCAGACGCCGTGCCTTTGCGGATACTTCAAGAATCCAGAATTCAAGCCTTACGTTACTGGCGGCAAACGGGTTGCTGCTGCTTGCGGCCTCACCGTTCCTGAGTGTTAG MKRLSISSLCVLVAAVATMALLTGAPVADAVDCNPSELSPCLPAITSSTPPTSSCCQKMVEQTPCLCGYFKNPEFKPYVTGGKRVAAACGLTVPEC Homology
BLAST of CmoCh14G011930 vs. ExPASy Swiss-Prot
Match: Q43681 (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata OX=3917 PE=2 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 5.9e-19 Identity = 46/96 (47.92%), Postives = 63/96 (65.62%), Query Frame = 0
BLAST of CmoCh14G011930 vs. ExPASy Swiss-Prot
Match: P82353 (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca OX=36596 PE=1 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.2e-14 Identity = 34/68 (50.00%), Postives = 46/68 (67.65%), Query Frame = 0
BLAST of CmoCh14G011930 vs. ExPASy Swiss-Prot
Match: P86809 (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum OX=278110 PE=1 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 7.5e-14 Identity = 32/63 (50.79%), Postives = 46/63 (73.02%), Query Frame = 0
BLAST of CmoCh14G011930 vs. ExPASy Swiss-Prot
Match: P20145 (Probable non-specific lipid-transfer protein OS=Hordeum vulgare OX=4513 GN=LTP2 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.0e-07 Identity = 30/88 (34.09%), Postives = 41/88 (46.59%), Query Frame = 0
BLAST of CmoCh14G011930 vs. ExPASy TrEMBL
Match: A0A6J1GV37 (non-specific lipid-transfer protein 2-like OS=Cucurbita moschata OX=3662 GN=LOC111457740 PE=4 SV=1) HSP 1 Score: 194.9 bits (494), Expect = 1.5e-46 Identity = 96/96 (100.00%), Postives = 96/96 (100.00%), Query Frame = 0
BLAST of CmoCh14G011930 vs. ExPASy TrEMBL
Match: A0A0A0L0Z5 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G135200 PE=4 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 4.8e-24 Identity = 62/97 (63.92%), Postives = 72/97 (74.23%), Query Frame = 0
BLAST of CmoCh14G011930 vs. ExPASy TrEMBL
Match: A0A6J1D4R3 (non-specific lipid-transfer protein 2-like OS=Momordica charantia OX=3673 GN=LOC111016938 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 1.1e-20 Identity = 54/98 (55.10%), Postives = 69/98 (70.41%), Query Frame = 0
BLAST of CmoCh14G011930 vs. ExPASy TrEMBL
Match: A0A5A7VF50 (Non-specific lipid-transfer protein 2-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold218G00770 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 1.5e-20 Identity = 53/102 (51.96%), Postives = 76/102 (74.51%), Query Frame = 0
BLAST of CmoCh14G011930 vs. ExPASy TrEMBL
Match: A0A0A0KW09 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G141230 PE=4 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 2.5e-20 Identity = 53/102 (51.96%), Postives = 74/102 (72.55%), Query Frame = 0
BLAST of CmoCh14G011930 vs. NCBI nr
Match: XP_022955891.1 (non-specific lipid-transfer protein 2-like [Cucurbita moschata]) HSP 1 Score: 194.9 bits (494), Expect = 3.2e-46 Identity = 96/96 (100.00%), Postives = 96/96 (100.00%), Query Frame = 0
BLAST of CmoCh14G011930 vs. NCBI nr
Match: XP_023527040.1 (non-specific lipid-transfer protein 2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 191.8 bits (486), Expect = 2.7e-45 Identity = 94/96 (97.92%), Postives = 95/96 (98.96%), Query Frame = 0
BLAST of CmoCh14G011930 vs. NCBI nr
Match: KAG6581743.1 (hypothetical protein SDJN03_21745, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 191.8 bits (486), Expect = 2.7e-45 Identity = 94/96 (97.92%), Postives = 94/96 (97.92%), Query Frame = 0
BLAST of CmoCh14G011930 vs. NCBI nr
Match: XP_022148226.1 (non-specific lipid-transfer protein 2-like [Momordica charantia]) HSP 1 Score: 109.0 bits (271), Expect = 2.3e-20 Identity = 54/98 (55.10%), Postives = 69/98 (70.41%), Query Frame = 0
BLAST of CmoCh14G011930 vs. NCBI nr
Match: KAA0064159.1 (non-specific lipid-transfer protein 2-like [Cucumis melo var. makuwa] >TYK02870.1 non-specific lipid-transfer protein 2-like [Cucumis melo var. makuwa]) HSP 1 Score: 108.6 bits (270), Expect = 3.0e-20 Identity = 53/102 (51.96%), Postives = 76/102 (74.51%), Query Frame = 0
BLAST of CmoCh14G011930 vs. TAIR 10
Match: AT3G18280.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 89.0 bits (219), Expect = 2.3e-18 Identity = 42/93 (45.16%), Postives = 63/93 (67.74%), Query Frame = 0
BLAST of CmoCh14G011930 vs. TAIR 10
Match: AT1G48750.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 82.4 bits (202), Expect = 2.2e-16 Identity = 39/93 (41.94%), Postives = 59/93 (63.44%), Query Frame = 0
BLAST of CmoCh14G011930 vs. TAIR 10
Match: AT1G43667.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 77.0 bits (188), Expect = 9.0e-15 Identity = 28/66 (42.42%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of CmoCh14G011930 vs. TAIR 10
Match: AT1G07747.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 68.9 bits (167), Expect = 2.5e-12 Identity = 31/85 (36.47%), Postives = 45/85 (52.94%), Query Frame = 0
BLAST of CmoCh14G011930 vs. TAIR 10
Match: AT5G38195.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 68.6 bits (166), Expect = 3.2e-12 Identity = 33/98 (33.67%), Postives = 54/98 (55.10%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita moschata (Rifu) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|