![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Cmc11g0306221 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATACCTTATAGCTTCACATTGACAAGTCATTTTCTCATTACTTTGGGTCTCTCGTTTTCTCTTTTTATTGCTATTACTATAGTGGGATTTCAAAGAAATTGGCTTCATTTTTTCAGTTTTTTATTACCCGTAAGAGTTTCACTACCATTAGCACCTTTTTTAATACTCCTTGAGCTAATCCCTTATTGTTTTCGCGCATTAAGCTCATGA ATGATACCTTATAGCTTCACATTGACAAGTCATTTTCTCATTACTTTGGGTCTCTCGTTTTCTCTTTTTATTGCTATTACTATAGTGGGATTTCAAAGAAATTGGCTTCATTTTTTCAGTTTTTTATTACCCGTAAGAGTTTCACTACCATTAGCACCTTTTTTAATACTCCTTGAGCTAATCCCTTATTGTTTTCGCGCATTAAGCTCATGA ATGATACCTTATAGCTTCACATTGACAAGTCATTTTCTCATTACTTTGGGTCTCTCGTTTTCTCTTTTTATTGCTATTACTATAGTGGGATTTCAAAGAAATTGGCTTCATTTTTTCAGTTTTTTATTACCCGTAAGAGTTTCACTACCATTAGCACCTTTTTTAATACTCCTTGAGCTAATCCCTTATTGTTTTCGCGCATTAAGCTCATGA MIPYSFTLTSHFLITLGLSFSLFIAITIVGFQRNWLHFFSFLLPVRVSLPLAPFLILLELIPYCFRALSS Homology
BLAST of Cmc11g0306221 vs. NCBI nr
Match: ADV15979.1 (ATP synthase F0 subunit 6, partial [Cuscuta europaea]) HSP 1 Score: 117.5 bits (293), Expect = 4.7e-23 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. NCBI nr
Match: AEN56130.1 (ATPase subunit 6 [Cucumis melo subsp. melo] >AZP40292.1 ATPase subunit 6 [Cucumis melo var. momordica]) HSP 1 Score: 117.5 bits (293), Expect = 4.7e-23 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. NCBI nr
Match: YP_004849344.1 (ATPase subunit 6 [Cucumis sativus] >ADZ10771.1 ATPase subunit 6 [Cucumis sativus]) HSP 1 Score: 117.5 bits (293), Expect = 4.7e-23 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. NCBI nr
Match: XP_031096219.1 (uncharacterized protein LOC116000291 [Ipomoea triloba]) HSP 1 Score: 116.7 bits (291), Expect = 8.1e-23 Identity = 61/70 (87.14%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. NCBI nr
Match: ADV15977.1 (ATP synthase F0 subunit 6, partial [Cuscuta gronovii] >ADV15978.1 ATP synthase F0 subunit 6, partial [Cuscuta sandwichiana] >ADV15981.1 ATP synthase F0 subunit 6, partial [Convolvulus assyricus]) HSP 1 Score: 116.7 bits (291), Expect = 8.1e-23 Identity = 61/70 (87.14%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. ExPASy Swiss-Prot
Match: P05499 (ATP synthase subunit a OS=Nicotiana tabacum OX=4097 GN=ATP6 PE=3 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 3.1e-25 Identity = 60/70 (85.71%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of Cmc11g0306221 vs. ExPASy Swiss-Prot
Match: P05500 (ATP synthase subunit a OS=Oenothera berteroana OX=3950 GN=ATP6 PE=2 SV=2) HSP 1 Score: 111.3 bits (277), Expect = 4.4e-24 Identity = 59/69 (85.51%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. ExPASy Swiss-Prot
Match: Q04654 (ATP synthase subunit a OS=Vicia faba OX=3906 GN=ATP6 PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 4.4e-24 Identity = 59/69 (85.51%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. ExPASy Swiss-Prot
Match: P93298 (ATP synthase subunit a-1 OS=Arabidopsis thaliana OX=3702 GN=ATP6-1 PE=2 SV=2) HSP 1 Score: 109.4 bits (272), Expect = 1.7e-23 Identity = 58/69 (84.06%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. ExPASy Swiss-Prot
Match: P92547 (ATP synthase subunit a-2 OS=Arabidopsis thaliana OX=3702 GN=ATP6-2 PE=2 SV=2) HSP 1 Score: 109.4 bits (272), Expect = 1.7e-23 Identity = 58/69 (84.06%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. ExPASy TrEMBL
Match: G3EU41 (ATP synthase subunit a OS=Cucumis melo subsp. melo OX=412675 GN=atp6 PE=3 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 2.3e-23 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. ExPASy TrEMBL
Match: E7E1Y7 (ATP synthase subunit a (Fragment) OS=Cuscuta europaea OX=41803 GN=atp6 PE=3 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 2.3e-23 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. ExPASy TrEMBL
Match: G3EIZ6 (ATP synthase subunit a OS=Cucumis sativus OX=3659 GN=atp6 PE=3 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 2.3e-23 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. ExPASy TrEMBL
Match: A0A3S5HPI7 (ATP synthase subunit a OS=Cucumis melo var. momordica OX=2034244 GN=atp6 PE=3 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 2.3e-23 Identity = 62/70 (88.57%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. ExPASy TrEMBL
Match: E7E1Y9 (ATP synthase subunit a (Fragment) OS=Convolvulus assyricus OX=197366 GN=atp6 PE=3 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 3.9e-23 Identity = 61/70 (87.14%), Postives = 65/70 (92.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. TAIR 10
Match: AT2G07741.1 (ATPase, F0 complex, subunit A protein ) HSP 1 Score: 109.4 bits (272), Expect = 1.2e-24 Identity = 58/69 (84.06%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. TAIR 10
Match: ATMG01170.1 (ATPase, F0 complex, subunit A protein ) HSP 1 Score: 109.4 bits (272), Expect = 1.2e-24 Identity = 58/69 (84.06%), Postives = 62/69 (89.86%), Query Frame = 0
BLAST of Cmc11g0306221 vs. TAIR 10
Match: ATMG00410.1 (ATPase subunit 6-1 ) HSP 1 Score: 109.4 bits (272), Expect = 1.2e-24 Identity = 58/69 (84.06%), Postives = 62/69 (89.86%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|