Cmc11g0301351 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGCTTATGTATTGACTACAGGGAGTTGAATAAGATAACTGTTAAGAACAAATATCCTTTGCCCAGGATCGATGATCTATTTGACCAGTTACAGGGAGCTACAGTGTTCTCTAAGAACGACCATCGGTCAGGATATCATCAGTTAAGGATTAAGGATAGTGATGTACCGAAAATAGCCTTTCGTTCTAGATATGGGCATTATGAGTTTATTGTGATGTCCTTCGGTTTGACGAATGCTCCAATAGTGTTTAGGGTTTGA ATGCGCTTATGTATTGACTACAGGGAGTTGAATAAGATAACTGTTAAGAACAAATATCCTTTGCCCAGGATCGATGATCTATTTGACCAGTTACAGGGAGCTACAGTGTTCTCTAAGAACGACCATCGGTCAGGATATCATCAGTTAAGGATTAAGGATAGTGATGTACCGAAAATAGCCTTTCGTTCTAGATATGGGCATTATGAGTTTATTGTGATGTCCTTCGGTTTGACGAATGCTCCAATAGTGTTTAGGGTTTGA ATGCGCTTATGTATTGACTACAGGGAGTTGAATAAGATAACTGTTAAGAACAAATATCCTTTGCCCAGGATCGATGATCTATTTGACCAGTTACAGGGAGCTACAGTGTTCTCTAAGAACGACCATCGGTCAGGATATCATCAGTTAAGGATTAAGGATAGTGATGTACCGAAAATAGCCTTTCGTTCTAGATATGGGCATTATGAGTTTATTGTGATGTCCTTCGGTTTGACGAATGCTCCAATAGTGTTTAGGGTTTGA MRLCIDYRELNKITVKNKYPLPRIDDLFDQLQGATVFSKNDHRSGYHQLRIKDSDVPKIAFRSRYGHYEFIVMSFGLTNAPIVFRV Homology
BLAST of Cmc11g0301351 vs. NCBI nr
Match: KAA0067347.1 (ty3-gypsy retrotransposon protein [Cucumis melo var. makuwa] >TYK30675.1 ty3-gypsy retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 179.1 bits (453), Expect = 1.6e-41 Identity = 84/86 (97.67%), Postives = 85/86 (98.84%), Query Frame = 0
BLAST of Cmc11g0301351 vs. NCBI nr
Match: ADN34002.1 (ty3-gypsy retrotransposon protein, partial [Cucumis melo subsp. melo]) HSP 1 Score: 167.2 bits (422), Expect = 6.4e-38 Identity = 78/84 (92.86%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of Cmc11g0301351 vs. NCBI nr
Match: KAA0052348.1 (putative gag-pol polyprotein [Cucumis melo var. makuwa]) HSP 1 Score: 166.0 bits (419), Expect = 1.4e-37 Identity = 78/84 (92.86%), Postives = 80/84 (95.24%), Query Frame = 0
BLAST of Cmc11g0301351 vs. NCBI nr
Match: KAA0033475.1 (pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 166.0 bits (419), Expect = 1.4e-37 Identity = 78/84 (92.86%), Postives = 80/84 (95.24%), Query Frame = 0
BLAST of Cmc11g0301351 vs. NCBI nr
Match: TYK01903.1 (putative gag-pol polyprotein [Cucumis melo var. makuwa]) HSP 1 Score: 166.0 bits (419), Expect = 1.4e-37 Identity = 78/84 (92.86%), Postives = 80/84 (95.24%), Query Frame = 0
BLAST of Cmc11g0301351 vs. ExPASy Swiss-Prot
Match: P31843 (RNA-directed DNA polymerase homolog OS=Oenothera berteroana OX=3950 PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.2e-23 Identity = 51/84 (60.71%), Postives = 62/84 (73.81%), Query Frame = 0
BLAST of Cmc11g0301351 vs. ExPASy Swiss-Prot
Match: Q99315 (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3) HSP 1 Score: 91.3 bits (225), Expect = 5.8e-18 Identity = 41/83 (49.40%), Postives = 55/83 (66.27%), Query Frame = 0
BLAST of Cmc11g0301351 vs. ExPASy Swiss-Prot
Match: Q7LHG5 (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2) HSP 1 Score: 91.3 bits (225), Expect = 5.8e-18 Identity = 41/83 (49.40%), Postives = 55/83 (66.27%), Query Frame = 0
BLAST of Cmc11g0301351 vs. ExPASy Swiss-Prot
Match: P0CT41 (Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-12 PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.9e-16 Identity = 36/85 (42.35%), Postives = 58/85 (68.24%), Query Frame = 0
BLAST of Cmc11g0301351 vs. ExPASy Swiss-Prot
Match: P0CT34 (Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-1 PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.9e-16 Identity = 36/85 (42.35%), Postives = 58/85 (68.24%), Query Frame = 0
BLAST of Cmc11g0301351 vs. ExPASy TrEMBL
Match: A0A5A7VJJ3 (Ty3-gypsy retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1704G00180 PE=4 SV=1) HSP 1 Score: 179.1 bits (453), Expect = 7.9e-42 Identity = 84/86 (97.67%), Postives = 85/86 (98.84%), Query Frame = 0
BLAST of Cmc11g0301351 vs. ExPASy TrEMBL
Match: E5GC03 (Ty3-gypsy retrotransposon protein (Fragment) OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 3.1e-38 Identity = 78/84 (92.86%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of Cmc11g0301351 vs. ExPASy TrEMBL
Match: A0A5A7UAV9 (Reverse transcriptase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold207G001870 PE=4 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 6.9e-38 Identity = 78/84 (92.86%), Postives = 80/84 (95.24%), Query Frame = 0
BLAST of Cmc11g0301351 vs. ExPASy TrEMBL
Match: A0A5D3BQD5 (Reverse transcriptase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold113G001680 PE=4 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 6.9e-38 Identity = 78/84 (92.86%), Postives = 80/84 (95.24%), Query Frame = 0
BLAST of Cmc11g0301351 vs. ExPASy TrEMBL
Match: A0A5A7SWD4 (Reverse transcriptase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold261G00050 PE=4 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 6.9e-38 Identity = 78/84 (92.86%), Postives = 80/84 (95.24%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
|