Cmc11g0299891 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCGGCGTTTGGGTGTTCGACAAAAATGGCGTGGCTCGTCTCATATCCAACCCAACCAGGGAGTCCTTCGAGTGCAAGGACCCGCCCCATCCAGGCACTGCCACCGCCCCGGGGGCTCGCCCCAGAGTCCTCGTCTACCTTCCAACCAACCAAGTCATACGGTCCTATGCCGAACTCGAGCAACGGCTGGCCGAACTCGGGTGGACTCGGTACCCAAATATAGCCGAACCGGATCTCCTCCAATTTCACCGCTCTCATGAATCGGCTCACTTGATTTCCCTCCCTAAAAGCTTCGCCAAATTTAAGCCCATGCATATGTATGACATTGTTGTCAAGAATCGCCATTTCTTTCAAGTTCGTGATCCCACCCCATCACCAACTTCTTTCAATTAG ATGTCCGGCGTTTGGGTGTTCGACAAAAATGGCGTGGCTCGTCTCATATCCAACCCAACCAGGGAGTCCTTCGAGTGCAAGGACCCGCCCCATCCAGGCACTGCCACCGCCCCGGGGGCTCGCCCCAGAGTCCTCGTCTACCTTCCAACCAACCAAGTCATACGGTCCTATGCCGAACTCGAGCAACGGCTGGCCGAACTCGGGTGGACTCGGTACCCAAATATAGCCGAACCGGATCTCCTCCAATTTCACCGCTCTCATGAATCGGCTCACTTGATTTCCCTCCCTAAAAGCTTCGCCAAATTTAAGCCCATGCATATGTATGACATTGTTGTCAAGAATCGCCATTTCTTTCAAGTTCGTGATCCCACCCCATCACCAACTTCTTTCAATTAG ATGTCCGGCGTTTGGGTGTTCGACAAAAATGGCGTGGCTCGTCTCATATCCAACCCAACCAGGGAGTCCTTCGAGTGCAAGGACCCGCCCCATCCAGGCACTGCCACCGCCCCGGGGGCTCGCCCCAGAGTCCTCGTCTACCTTCCAACCAACCAAGTCATACGGTCCTATGCCGAACTCGAGCAACGGCTGGCCGAACTCGGGTGGACTCGGTACCCAAATATAGCCGAACCGGATCTCCTCCAATTTCACCGCTCTCATGAATCGGCTCACTTGATTTCCCTCCCTAAAAGCTTCGCCAAATTTAAGCCCATGCATATGTATGACATTGTTGTCAAGAATCGCCATTTCTTTCAAGTTCGTGATCCCACCCCATCACCAACTTCTTTCAATTAG MSGVWVFDKNGVARLISNPTRESFECKDPPHPGTATAPGARPRVLVYLPTNQVIRSYAELEQRLAELGWTRYPNIAEPDLLQFHRSHESAHLISLPKSFAKFKPMHMYDIVVKNRHFFQVRDPTPSPTSFN Homology
BLAST of Cmc11g0299891 vs. NCBI nr
Match: KAG6570697.1 (Flowering-promoting factor 1, partial [Cucurbita argyrosperma subsp. sororia] >KAG7010544.1 Flowering-promoting factor 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 248.8 bits (634), Expect = 2.5e-62 Identity = 118/129 (91.47%), Postives = 122/129 (94.57%), Query Frame = 0
BLAST of Cmc11g0299891 vs. NCBI nr
Match: XP_022148408.1 (flowering-promoting factor 1-like [Momordica charantia]) HSP 1 Score: 223.8 bits (569), Expect = 8.8e-55 Identity = 111/131 (84.73%), Postives = 118/131 (90.08%), Query Frame = 0
BLAST of Cmc11g0299891 vs. NCBI nr
Match: BBH04787.1 (flowering promoting factor 1 [Prunus dulcis] >VVA23053.1 PREDICTED: flowering-promoting factor [Prunus dulcis]) HSP 1 Score: 218.4 bits (555), Expect = 3.7e-53 Identity = 103/123 (83.74%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Cmc11g0299891 vs. NCBI nr
Match: KAG6760852.1 (hypothetical protein POTOM_034035 [Populus tomentosa]) HSP 1 Score: 217.6 bits (553), Expect = 6.3e-53 Identity = 101/126 (80.16%), Postives = 111/126 (88.10%), Query Frame = 0
BLAST of Cmc11g0299891 vs. NCBI nr
Match: XP_021647625.1 (flowering-promoting factor 1-like protein 1 [Hevea brasiliensis]) HSP 1 Score: 217.6 bits (553), Expect = 6.3e-53 Identity = 101/124 (81.45%), Postives = 113/124 (91.13%), Query Frame = 0
BLAST of Cmc11g0299891 vs. ExPASy Swiss-Prot
Match: O23624 (Flowering-promoting factor 1 OS=Arabidopsis thaliana OX=3702 GN=FPF1 PE=1 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 4.4e-25 Identity = 61/122 (50.00%), Postives = 78/122 (63.93%), Query Frame = 0
BLAST of Cmc11g0299891 vs. ExPASy Swiss-Prot
Match: O24340 (Flowering-promoting factor 1 OS=Sinapis alba OX=3728 GN=FPF1 PE=2 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 4.4e-25 Identity = 63/122 (51.64%), Postives = 77/122 (63.11%), Query Frame = 0
BLAST of Cmc11g0299891 vs. ExPASy Swiss-Prot
Match: Q0E1D7 (Flowering-promoting factor 1-like protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0460200 PE=2 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 1.3e-24 Identity = 64/133 (48.12%), Postives = 87/133 (65.41%), Query Frame = 0
BLAST of Cmc11g0299891 vs. ExPASy Swiss-Prot
Match: Q5Q0B3 (Flowering-promoting factor 1-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FLP1 PE=2 SV=2) HSP 1 Score: 112.8 bits (281), Expect = 2.9e-24 Identity = 61/124 (49.19%), Postives = 80/124 (64.52%), Query Frame = 0
BLAST of Cmc11g0299891 vs. ExPASy Swiss-Prot
Match: Q9LXB5 (Flowering-promoting factor 1-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=FLP2 PE=2 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 3.2e-23 Identity = 60/122 (49.18%), Postives = 77/122 (63.11%), Query Frame = 0
BLAST of Cmc11g0299891 vs. ExPASy TrEMBL
Match: A0A0A0KE84 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G190350 PE=3 SV=1) HSP 1 Score: 273.1 bits (697), Expect = 6.1e-70 Identity = 128/131 (97.71%), Postives = 130/131 (99.24%), Query Frame = 0
BLAST of Cmc11g0299891 vs. ExPASy TrEMBL
Match: A0A6J1D405 (flowering-promoting factor 1-like OS=Momordica charantia OX=3673 GN=LOC111017063 PE=3 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 4.2e-55 Identity = 111/131 (84.73%), Postives = 118/131 (90.08%), Query Frame = 0
BLAST of Cmc11g0299891 vs. ExPASy TrEMBL
Match: A0A4Y1RLM7 (Flowering promoting factor 1 OS=Prunus dulcis OX=3755 GN=ALMOND_2B008132 PE=3 SV=1) HSP 1 Score: 218.4 bits (555), Expect = 1.8e-53 Identity = 103/123 (83.74%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Cmc11g0299891 vs. ExPASy TrEMBL
Match: M5WHZ4 (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_6G075900 PE=3 SV=1) HSP 1 Score: 217.2 bits (552), Expect = 4.0e-53 Identity = 102/123 (82.93%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Cmc11g0299891 vs. ExPASy TrEMBL
Match: A0A6J5V2H6 (Uncharacterized protein OS=Prunus armeniaca OX=36596 GN=CURHAP_LOCUS35930 PE=3 SV=1) HSP 1 Score: 217.2 bits (552), Expect = 4.0e-53 Identity = 102/123 (82.93%), Postives = 110/123 (89.43%), Query Frame = 0
BLAST of Cmc11g0299891 vs. TAIR 10
Match: AT5G24860.1 (flowering promoting factor 1 ) HSP 1 Score: 115.5 bits (288), Expect = 3.1e-26 Identity = 61/122 (50.00%), Postives = 78/122 (63.93%), Query Frame = 0
BLAST of Cmc11g0299891 vs. TAIR 10
Match: AT4G31380.1 (FPF1-like protein 1 ) HSP 1 Score: 112.8 bits (281), Expect = 2.0e-25 Identity = 61/124 (49.19%), Postives = 80/124 (64.52%), Query Frame = 0
BLAST of Cmc11g0299891 vs. TAIR 10
Match: AT5G10625.1 (BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 109.4 bits (272), Expect = 2.2e-24 Identity = 60/122 (49.18%), Postives = 77/122 (63.11%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|