Cmc11g0294191 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCCTTCTCATCCTTCTTCTCTTCGTCTTCACCATCTTTGCCTTCACCGTCACCAACAAAGGCGCCAGAAAAGTTCCCTCGAACAGAGGATATAAAGAGTATAGACTCGGTGATTACTCCAACTGGCTACAGAATCACGTCAGGAACAACAAAGATTGGAATAGAATCAGAAGTTGTTTAGTCGACGACAAGGTCTGTGCTGAATTCAACCAGAAATTCGCTTCTGAAACCATTGATCAATTCTACCAATGA ATGTTCCTTCTCATCCTTCTTCTCTTCGTCTTCACCATCTTTGCCTTCACCGTCACCAACAAAGGCGCCAGAAAAGTTCCCTCGAACAGAGGATATAAAGAGTATAGACTCGGTGATTACTCCAACTGGCTACAGAATCACGTCAGGAACAACAAAGATTGGAATAGAATCAGAAGTTGTTTAGTCGACGACAAGGTCTGTGCTGAATTCAACCAGAAATTCGCTTCTGAAACCATTGATCAATTCTACCAATGA ATGTTCCTTCTCATCCTTCTTCTCTTCGTCTTCACCATCTTTGCCTTCACCGTCACCAACAAAGGCGCCAGAAAAGTTCCCTCGAACAGAGGATATAAAGAGTATAGACTCGGTGATTACTCCAACTGGCTACAGAATCACGTCAGGAACAACAAAGATTGGAATAGAATCAGAAGTTGTTTAGTCGACGACAAGGTCTGTGCTGAATTCAACCAGAAATTCGCTTCTGAAACCATTGATCAATTCTACCAATGA MFLLILLLFVFTIFAFTVTNKGARKVPSNRGYKEYRLGDYSNWLQNHVRNNKDWNRIRSCLVDDKVCAEFNQKFASETIDQFYQ Homology
BLAST of Cmc11g0294191 vs. NCBI nr
Match: TYK28907.1 (tetraspanin-8-like [Cucumis melo var. makuwa]) HSP 1 Score: 164.1 bits (414), Expect = 5.3e-37 Identity = 80/84 (95.24%), Postives = 80/84 (95.24%), Query Frame = 0
BLAST of Cmc11g0294191 vs. NCBI nr
Match: XP_008443811.1 (PREDICTED: tetraspanin-8-like [Cucumis melo] >KAA0035124.1 tetraspanin-8-like [Cucumis melo var. makuwa] >TYJ95956.1 tetraspanin-8-like [Cucumis melo var. makuwa]) HSP 1 Score: 154.8 bits (390), Expect = 3.2e-34 Identity = 76/84 (90.48%), Postives = 78/84 (92.86%), Query Frame = 0
BLAST of Cmc11g0294191 vs. NCBI nr
Match: XP_038880175.1 (tetraspanin-8-like [Benincasa hispida]) HSP 1 Score: 146.4 bits (368), Expect = 1.1e-31 Identity = 68/84 (80.95%), Postives = 77/84 (91.67%), Query Frame = 0
BLAST of Cmc11g0294191 vs. NCBI nr
Match: KAA0048788.1 (tetraspanin-8-like [Cucumis melo var. makuwa] >TYK31544.1 tetraspanin-8-like [Cucumis melo var. makuwa]) HSP 1 Score: 146.0 bits (367), Expect = 1.5e-31 Identity = 71/84 (84.52%), Postives = 76/84 (90.48%), Query Frame = 0
BLAST of Cmc11g0294191 vs. NCBI nr
Match: XP_004151158.1 (tetraspanin-8 [Cucumis sativus] >KGN65268.1 hypothetical protein Csa_019831 [Cucumis sativus]) HSP 1 Score: 145.2 bits (365), Expect = 2.5e-31 Identity = 71/83 (85.54%), Postives = 74/83 (89.16%), Query Frame = 0
BLAST of Cmc11g0294191 vs. ExPASy Swiss-Prot
Match: Q8S8Q6 (Tetraspanin-8 OS=Arabidopsis thaliana OX=3702 GN=TET8 PE=2 SV=1) HSP 1 Score: 107.8 bits (268), Expect = 5.9e-23 Identity = 49/84 (58.33%), Postives = 63/84 (75.00%), Query Frame = 0
BLAST of Cmc11g0294191 vs. ExPASy Swiss-Prot
Match: Q9SUD4 (Tetraspanin-7 OS=Arabidopsis thaliana OX=3702 GN=TET7 PE=2 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 8.5e-22 Identity = 50/84 (59.52%), Postives = 63/84 (75.00%), Query Frame = 0
BLAST of Cmc11g0294191 vs. ExPASy Swiss-Prot
Match: Q9M0B7 (Tetraspanin-9 OS=Arabidopsis thaliana OX=3702 GN=TET9 PE=2 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.4e-16 Identity = 42/84 (50.00%), Postives = 53/84 (63.10%), Query Frame = 0
BLAST of Cmc11g0294191 vs. ExPASy Swiss-Prot
Match: Q9ZUN5 (Tetraspanin-2 OS=Arabidopsis thaliana OX=3702 GN=TET2 PE=2 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 5.0e-14 Identity = 44/84 (52.38%), Postives = 58/84 (69.05%), Query Frame = 0
BLAST of Cmc11g0294191 vs. ExPASy Swiss-Prot
Match: Q9LPR6 (Tetraspanin-11 OS=Arabidopsis thaliana OX=3702 GN=TET11 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.2e-13 Identity = 39/79 (49.37%), Postives = 48/79 (60.76%), Query Frame = 0
BLAST of Cmc11g0294191 vs. ExPASy TrEMBL
Match: A0A5D3DYD6 (Tetraspanin-8-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold3695G00100 PE=4 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 2.6e-37 Identity = 80/84 (95.24%), Postives = 80/84 (95.24%), Query Frame = 0
BLAST of Cmc11g0294191 vs. ExPASy TrEMBL
Match: A0A5A7SV27 (Tetraspanin-8-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold271G00210 PE=3 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 1.6e-34 Identity = 76/84 (90.48%), Postives = 78/84 (92.86%), Query Frame = 0
BLAST of Cmc11g0294191 vs. ExPASy TrEMBL
Match: A0A1S3B8W0 (tetraspanin-8-like OS=Cucumis melo OX=3656 GN=LOC103487314 PE=3 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 1.6e-34 Identity = 76/84 (90.48%), Postives = 78/84 (92.86%), Query Frame = 0
BLAST of Cmc11g0294191 vs. ExPASy TrEMBL
Match: A0A5A7U0Q3 (Tetraspanin-8-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold172G00300 PE=4 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 7.2e-32 Identity = 71/84 (84.52%), Postives = 76/84 (90.48%), Query Frame = 0
BLAST of Cmc11g0294191 vs. ExPASy TrEMBL
Match: A0A0A0LTZ1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G287020 PE=3 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 1.2e-31 Identity = 71/83 (85.54%), Postives = 74/83 (89.16%), Query Frame = 0
BLAST of Cmc11g0294191 vs. TAIR 10
Match: AT2G23810.1 (tetraspanin8 ) HSP 1 Score: 107.8 bits (268), Expect = 4.2e-24 Identity = 49/84 (58.33%), Postives = 63/84 (75.00%), Query Frame = 0
BLAST of Cmc11g0294191 vs. TAIR 10
Match: AT4G28050.1 (tetraspanin7 ) HSP 1 Score: 104.0 bits (258), Expect = 6.0e-23 Identity = 50/84 (59.52%), Postives = 63/84 (75.00%), Query Frame = 0
BLAST of Cmc11g0294191 vs. TAIR 10
Match: AT4G30430.1 (tetraspanin9 ) HSP 1 Score: 85.9 bits (211), Expect = 1.7e-17 Identity = 42/84 (50.00%), Postives = 53/84 (63.10%), Query Frame = 0
BLAST of Cmc11g0294191 vs. TAIR 10
Match: AT2G19580.1 (tetraspanin2 ) HSP 1 Score: 78.2 bits (191), Expect = 3.5e-15 Identity = 44/84 (52.38%), Postives = 58/84 (69.05%), Query Frame = 0
BLAST of Cmc11g0294191 vs. TAIR 10
Match: AT1G18520.1 (tetraspanin11 ) HSP 1 Score: 74.3 bits (181), Expect = 5.1e-14 Identity = 39/79 (49.37%), Postives = 48/79 (60.76%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|