Cmc11g0293011 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTATGCTTACTATTTCTTGTGCTCAATTGGGATAAAACCAAAGTGGAAAAAATTTGTTACTAACTGCCAAATTTTGCAGTTAGTGTTTGGGTTTGTGGTTTCGGGTTGGATGTTGTATGAGCATTTCATTGGTGGATCGTCATTATCCCTTGGTGGATGCTCGGGTATCAGGGGTTGGTATTTCAATATTGTTTTCAATGCCTCTCTTTTGGCTCTTTTCATGGACTTTCATTCTAAAAGCTATGTGTTGCACGGCCAACGCAAACAACAATAA ATGTATGCTTACTATTTCTTGTGCTCAATTGGGATAAAACCAAAGTGGAAAAAATTTGTTACTAACTGCCAAATTTTGCAGTTAGTGTTTGGGTTTGTGGTTTCGGGTTGGATGTTGTATGAGCATTTCATTGGTGGATCGTCATTATCCCTTGGTGGATGCTCGGGTATCAGGGGTTGGTATTTCAATATTGTTTTCAATGCCTCTCTTTTGGCTCTTTTCATGGACTTTCATTCTAAAAGCTATGTGTTGCACGGCCAACGCAAACAACAATAA ATGTATGCTTACTATTTCTTGTGCTCAATTGGGATAAAACCAAAGTGGAAAAAATTTGTTACTAACTGCCAAATTTTGCAGTTAGTGTTTGGGTTTGTGGTTTCGGGTTGGATGTTGTATGAGCATTTCATTGGTGGATCGTCATTATCCCTTGGTGGATGCTCGGGTATCAGGGGTTGGTATTTCAATATTGTTTTCAATGCCTCTCTTTTGGCTCTTTTCATGGACTTTCATTCTAAAAGCTATGTGTTGCACGGCCAACGCAAACAACAATAA MYAYYFLCSIGIKPKWKKFVTNCQILQLVFGFVVSGWMLYEHFIGGSSLSLGGCSGIRGWYFNIVFNASLLALFMDFHSKSYVLHGQRKQQ Homology
BLAST of Cmc11g0293011 vs. NCBI nr
Match: XP_008455969.2 (PREDICTED: elongation of fatty acids protein 3-like [Cucumis melo]) HSP 1 Score: 194.5 bits (493), Expect = 4.0e-46 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 0
BLAST of Cmc11g0293011 vs. NCBI nr
Match: XP_038888900.1 (elongation of fatty acids protein 3-like [Benincasa hispida]) HSP 1 Score: 144.1 bits (362), Expect = 6.1e-31 Identity = 68/85 (80.00%), Postives = 73/85 (85.88%), Query Frame = 0
BLAST of Cmc11g0293011 vs. NCBI nr
Match: XP_022155013.1 (elongation of fatty acids protein 3-like [Momordica charantia]) HSP 1 Score: 128.3 bits (321), Expect = 3.5e-26 Identity = 59/89 (66.29%), Postives = 70/89 (78.65%), Query Frame = 0
BLAST of Cmc11g0293011 vs. NCBI nr
Match: XP_022927675.1 (elongation of fatty acids protein 3-like [Cucurbita moschata]) HSP 1 Score: 127.9 bits (320), Expect = 4.5e-26 Identity = 59/91 (64.84%), Postives = 73/91 (80.22%), Query Frame = 0
BLAST of Cmc11g0293011 vs. NCBI nr
Match: KAG6588814.1 (Elongation of fatty acids protein 3-like protein, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 127.9 bits (320), Expect = 4.5e-26 Identity = 59/91 (64.84%), Postives = 73/91 (80.22%), Query Frame = 0
BLAST of Cmc11g0293011 vs. ExPASy Swiss-Prot
Match: P40319 (Elongation of fatty acids protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ELO3 PE=1 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 1.0e-04 Identity = 31/93 (33.33%), Postives = 49/93 (52.69%), Query Frame = 0
BLAST of Cmc11g0293011 vs. ExPASy Swiss-Prot
Match: Q9SYY4 (Elongation of fatty acids protein 3-like OS=Arabidopsis thaliana OX=3702 GN=HOS3 PE=2 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 5.1e-04 Identity = 26/83 (31.33%), Postives = 41/83 (49.40%), Query Frame = 0
BLAST of Cmc11g0293011 vs. ExPASy Swiss-Prot
Match: Q54CJ4 (Elongation of fatty acids protein A OS=Dictyostelium discoideum OX=44689 GN=eloA PE=2 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 6.6e-04 Identity = 29/85 (34.12%), Postives = 41/85 (48.24%), Query Frame = 0
BLAST of Cmc11g0293011 vs. ExPASy TrEMBL
Match: A0A1S3C245 (elongation of fatty acids protein 3-like OS=Cucumis melo OX=3656 GN=LOC103496032 PE=4 SV=1) HSP 1 Score: 194.5 bits (493), Expect = 1.9e-46 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 0
BLAST of Cmc11g0293011 vs. ExPASy TrEMBL
Match: A0A6J1DLU5 (Very-long-chain 3-oxoacyl-CoA synthase OS=Momordica charantia OX=3673 GN=LOC111022155 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 1.7e-26 Identity = 59/89 (66.29%), Postives = 70/89 (78.65%), Query Frame = 0
BLAST of Cmc11g0293011 vs. ExPASy TrEMBL
Match: A0A6J1EPN2 (Very-long-chain 3-oxoacyl-CoA synthase OS=Cucurbita moschata OX=3662 GN=LOC111434494 PE=4 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 2.2e-26 Identity = 59/91 (64.84%), Postives = 73/91 (80.22%), Query Frame = 0
BLAST of Cmc11g0293011 vs. ExPASy TrEMBL
Match: A0A6J1JN46 (Very-long-chain 3-oxoacyl-CoA synthase OS=Cucurbita maxima OX=3661 GN=LOC111486707 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 8.4e-26 Identity = 59/91 (64.84%), Postives = 71/91 (78.02%), Query Frame = 0
BLAST of Cmc11g0293011 vs. ExPASy TrEMBL
Match: A0A0A0KJH8 (Very-long-chain 3-oxoacyl-CoA synthase OS=Cucumis sativus OX=3659 GN=Csa_6G411300 PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 3.2e-25 Identity = 59/89 (66.29%), Postives = 70/89 (78.65%), Query Frame = 0
BLAST of Cmc11g0293011 vs. TAIR 10
Match: AT3G06470.1 (GNS1/SUR4 membrane protein family ) HSP 1 Score: 114.4 bits (285), Expect = 4.8e-26 Identity = 52/83 (62.65%), Postives = 62/83 (74.70%), Query Frame = 0
BLAST of Cmc11g0293011 vs. TAIR 10
Match: AT3G06460.1 (GNS1/SUR4 membrane protein family ) HSP 1 Score: 95.1 bits (235), Expect = 3.0e-20 Identity = 48/83 (57.83%), Postives = 58/83 (69.88%), Query Frame = 0
BLAST of Cmc11g0293011 vs. TAIR 10
Match: AT4G36830.1 (GNS1/SUR4 membrane protein family ) HSP 1 Score: 45.1 bits (105), Expect = 3.6e-05 Identity = 26/83 (31.33%), Postives = 41/83 (49.40%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|