Cmc11g0288181 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAATCCGTCTGCCATCGATTCTTCTCAACGCCAAGCAGATTTTGAAAATGCAAGCTATGTCAGCCAGAAATCAATCTGATGTTCCCAAAGGCCATATTGCAGTTTACGTGGGAGAGATTCAAAGGAAGAGATTTGTCGTCCCTATATCATACTTGAAGCATCCTTCTTTTGTAGATCTGCTCAATAGATCAGAAGAAGAATTTGGATTTTGCCACCCAACGGGCGGCTTGACGATTCCATGCCGAGAGGATGCTTTCATAAATCTCACTGCTAAGCTGCACACATCTTGA ATGGGAATCCGTCTGCCATCGATTCTTCTCAACGCCAAGCAGATTTTGAAAATGCAAGCTATGTCAGCCAGAAATCAATCTGATGTTCCCAAAGGCCATATTGCAGTTTACGTGGGAGAGATTCAAAGGAAGAGATTTGTCGTCCCTATATCATACTTGAAGCATCCTTCTTTTGTAGATCTGCTCAATAGATCAGAAGAAGAATTTGGATTTTGCCACCCAACGGGCGGCTTGACGATTCCATGCCGAGAGGATGCTTTCATAAATCTCACTGCTAAGCTGCACACATCTTGA ATGGGAATCCGTCTGCCATCGATTCTTCTCAACGCCAAGCAGATTTTGAAAATGCAAGCTATGTCAGCCAGAAATCAATCTGATGTTCCCAAAGGCCATATTGCAGTTTACGTGGGAGAGATTCAAAGGAAGAGATTTGTCGTCCCTATATCATACTTGAAGCATCCTTCTTTTGTAGATCTGCTCAATAGATCAGAAGAAGAATTTGGATTTTGCCACCCAACGGGCGGCTTGACGATTCCATGCCGAGAGGATGCTTTCATAAATCTCACTGCTAAGCTGCACACATCTTGA MGIRLPSILLNAKQILKMQAMSARNQSDVPKGHIAVYVGEIQRKRFVVPISYLKHPSFVDLLNRSEEEFGFCHPTGGLTIPCREDAFINLTAKLHTS Homology
BLAST of Cmc11g0288181 vs. NCBI nr
Match: XP_016902145.1 (PREDICTED: auxin-responsive protein SAUR21-like [Cucumis melo] >KAA0045683.1 auxin-responsive protein SAUR21-like [Cucumis melo var. makuwa] >TYJ99601.1 auxin-responsive protein SAUR21-like [Cucumis melo var. makuwa]) HSP 1 Score: 200.3 bits (508), Expect = 7.7e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of Cmc11g0288181 vs. NCBI nr
Match: XP_011649278.1 (auxin-responsive protein SAUR21 [Cucumis sativus]) HSP 1 Score: 196.4 bits (498), Expect = 1.1e-46 Identity = 94/97 (96.91%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Cmc11g0288181 vs. NCBI nr
Match: XP_038901157.1 (auxin-responsive protein SAUR21-like [Benincasa hispida]) HSP 1 Score: 195.3 bits (495), Expect = 2.5e-46 Identity = 93/97 (95.88%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Cmc11g0288181 vs. NCBI nr
Match: XP_031736840.1 (auxin-responsive protein SAUR21 [Cucumis sativus] >KAE8651888.1 hypothetical protein Csa_005909 [Cucumis sativus]) HSP 1 Score: 194.5 bits (493), Expect = 4.2e-46 Identity = 94/97 (96.91%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of Cmc11g0288181 vs. NCBI nr
Match: XP_038901158.1 (auxin-responsive protein SAUR21-like [Benincasa hispida]) HSP 1 Score: 193.7 bits (491), Expect = 7.2e-46 Identity = 91/97 (93.81%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of Cmc11g0288181 vs. ExPASy Swiss-Prot
Match: Q9FJF6 (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana OX=3702 GN=SAUR23 PE=2 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.0e-23 Identity = 55/87 (63.22%), Postives = 67/87 (77.01%), Query Frame = 0
BLAST of Cmc11g0288181 vs. ExPASy Swiss-Prot
Match: Q9FJG1 (Auxin-responsive protein SAUR19 OS=Arabidopsis thaliana OX=3702 GN=SAUR19 PE=2 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 4.0e-23 Identity = 53/86 (61.63%), Postives = 65/86 (75.58%), Query Frame = 0
BLAST of Cmc11g0288181 vs. ExPASy Swiss-Prot
Match: Q9FJG0 (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana OX=3702 GN=SAUR20 PE=1 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.2e-23 Identity = 53/85 (62.35%), Postives = 64/85 (75.29%), Query Frame = 0
BLAST of Cmc11g0288181 vs. ExPASy Swiss-Prot
Match: Q9FJF9 (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana OX=3702 GN=SAUR21 PE=2 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 5.2e-23 Identity = 53/86 (61.63%), Postives = 64/86 (74.42%), Query Frame = 0
BLAST of Cmc11g0288181 vs. ExPASy Swiss-Prot
Match: Q9FK62 (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana OX=3702 GN=SAUR24 PE=2 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 8.9e-23 Identity = 53/86 (61.63%), Postives = 65/86 (75.58%), Query Frame = 0
BLAST of Cmc11g0288181 vs. ExPASy TrEMBL
Match: A0A5A7TQ57 (Auxin-responsive protein SAUR21-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold123G001750 PE=3 SV=1) HSP 1 Score: 200.3 bits (508), Expect = 3.7e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of Cmc11g0288181 vs. ExPASy TrEMBL
Match: A0A1S4E2E4 (auxin-responsive protein SAUR21-like OS=Cucumis melo OX=3656 GN=LOC107991554 PE=3 SV=1) HSP 1 Score: 200.3 bits (508), Expect = 3.7e-48 Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of Cmc11g0288181 vs. ExPASy TrEMBL
Match: A0A6J1CYI0 (auxin-responsive protein SAUR21-like OS=Momordica charantia OX=3673 GN=LOC111015450 PE=3 SV=1) HSP 1 Score: 193.4 bits (490), Expect = 4.5e-46 Identity = 93/97 (95.88%), Postives = 96/97 (98.97%), Query Frame = 0
BLAST of Cmc11g0288181 vs. ExPASy TrEMBL
Match: A0A5D3BIN4 (Auxin-responsive protein SAUR21-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold123G001760 PE=3 SV=1) HSP 1 Score: 191.8 bits (486), Expect = 1.3e-45 Identity = 92/97 (94.85%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of Cmc11g0288181 vs. ExPASy TrEMBL
Match: A0A0A0LM74 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G258830 PE=3 SV=1) HSP 1 Score: 191.8 bits (486), Expect = 1.3e-45 Identity = 93/97 (95.88%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of Cmc11g0288181 vs. TAIR 10
Match: AT4G38840.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 117.1 bits (292), Expect = 8.0e-27 Identity = 55/99 (55.56%), Postives = 74/99 (74.75%), Query Frame = 0
BLAST of Cmc11g0288181 vs. TAIR 10
Match: AT2G21210.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 115.2 bits (287), Expect = 3.0e-26 Identity = 55/98 (56.12%), Postives = 75/98 (76.53%), Query Frame = 0
BLAST of Cmc11g0288181 vs. TAIR 10
Match: AT4G34810.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 112.8 bits (281), Expect = 1.5e-25 Identity = 56/101 (55.45%), Postives = 75/101 (74.26%), Query Frame = 0
BLAST of Cmc11g0288181 vs. TAIR 10
Match: AT5G18060.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 110.5 bits (275), Expect = 7.5e-25 Identity = 55/87 (63.22%), Postives = 67/87 (77.01%), Query Frame = 0
BLAST of Cmc11g0288181 vs. TAIR 10
Match: AT4G34800.1 (SAUR-like auxin-responsive protein family ) HSP 1 Score: 109.4 bits (272), Expect = 1.7e-24 Identity = 58/92 (63.04%), Postives = 68/92 (73.91%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|