Cmc10g0261051 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTGGGCATACTATTGCTATTCATAATGGAAAGGACCATTTGCCTGTTTATATAACGGATCGTATGGTAGGTCATAAATTGGGAGAATTCGCACCCACTCGCAATTTCCGGGGGCATGTGAAAAATGATAATAGACCTCGTCGTTAA ATGATTGGGCATACTATTGCTATTCATAATGGAAAGGACCATTTGCCTGTTTATATAACGGATCGTATGGTAGGTCATAAATTGGGAGAATTCGCACCCACTCGCAATTTCCGGGGGCATGTGAAAAATGATAATAGACCTCGTCGTTAA ATGATTGGGCATACTATTGCTATTCATAATGGAAAGGACCATTTGCCTGTTTATATAACGGATCGTATGGTAGGTCATAAATTGGGAGAATTCGCACCCACTCGCAATTTCCGGGGGCATGTGAAAAATGATAATAGACCTCGTCGTTAA MIGHTIAIHNGKDHLPVYITDRMVGHKLGEFAPTRNFRGHVKNDNRPRR Homology
BLAST of Cmc10g0261051 vs. NCBI nr
Match: ASY96372.1 (ribosomal protein S19 [Cucumis melo subsp. agrestis] >ASY96632.1 ribosomal protein S19 [Cucumis melo var. conomon] >ASY96720.1 ribosomal protein S19 [Cucumis melo var. makuwa] >ASY96807.1 ribosomal protein S19 [Cucumis melo var. momordica] >ASY96894.1 ribosomal protein S19 [Cucumis melo var. dudaim] >ASY96981.1 ribosomal protein S19 [Cucumis melo var. cantalupo] >ASY97155.1 ribosomal protein S19 [Cucumis melo var. inodorus] >ASY97329.1 ribosomal protein S19 [Cucumis melo var. flexuosus]) HSP 1 Score: 109.0 bits (271), Expect = 1.2e-20 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 0
BLAST of Cmc10g0261051 vs. NCBI nr
Match: YP_004841824.1 (ribosomal protein S19 [Cucumis melo subsp. melo] >YP_009860114.1 ribosomal protein S19 [Cucumis melo subsp. agrestis] >QJF46425.1 ribosomal protein S19 [Cucumis melo] >AEM76933.1 ribosomal protein S19 [Cucumis melo subsp. melo] >QKK36697.1 ribosomal protein S19 [Cucumis melo subsp. agrestis] >QRW36595.1 ribosomal protein S19 [Cucumis melo]) HSP 1 Score: 109.0 bits (271), Expect = 1.2e-20 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 0
BLAST of Cmc10g0261051 vs. NCBI nr
Match: YP_009430667.1 (ribosomal protein S19 [Gynostemma cardiospermum] >YP_009439844.1 ribosomal protein S19 [Gynostemma laxiflorum] >YP_010015179.1 ribosomal protein S19 [Gynostemma yixingense] >ART65105.1 ribosomal protein S19 [Gynostemma cardiospermum] >ATG86685.1 ribosomal protein S19 [Gynostemma laxiflorum] >QOI14304.1 ribosomal protein S19 [Gynostemma yixingense]) HSP 1 Score: 105.9 bits (263), Expect = 1.0e-19 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 0
BLAST of Cmc10g0261051 vs. NCBI nr
Match: QHB76004.1 (ribosomal protein S19 [Cucumis melo subsp. melo] >QHB76030.1 ribosomal protein S19 [Cucumis melo subsp. melo]) HSP 1 Score: 105.9 bits (263), Expect = 1.0e-19 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 0
BLAST of Cmc10g0261051 vs. NCBI nr
Match: YP_009004083.1 (ribosomal protein S19 [Cucumis hystrix] >YP_009346520.1 ribosomal protein S19 [Cucumis x hytivus] >YP_247640.1 ribosomal protein S19 [Cucumis sativus] >Q4VZM8.1 RecName: Full=30S ribosomal protein S19, chloroplastic [Cucumis sativus] >ALF03342.1 ribosomal protein S19 [Cucumis sativus var. hardwickii] >AVE15372.1 ribosomal protein S19 [Cucumis sativus var. sativus] >AAZ94690.1 ribosomal protein S19 [Cucumis sativus] >ABI97457.1 ribosomal protein S19 [Cucumis sativus] >ABI98786.1 ribosomal protein S19 [Cucumis sativus]) HSP 1 Score: 105.5 bits (262), Expect = 1.3e-19 Identity = 47/49 (95.92%), Postives = 48/49 (97.96%), Query Frame = 0
BLAST of Cmc10g0261051 vs. ExPASy Swiss-Prot
Match: Q4VZM8 (30S ribosomal protein S19, chloroplastic OS=Cucumis sativus OX=3659 GN=rps19 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 1.7e-22 Identity = 47/49 (95.92%), Postives = 48/49 (97.96%), Query Frame = 0
BLAST of Cmc10g0261051 vs. ExPASy Swiss-Prot
Match: Q09G05 (30S ribosomal protein S19, chloroplastic OS=Platanus occidentalis OX=4403 GN=rps19 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 7.2e-21 Identity = 44/49 (89.80%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of Cmc10g0261051 vs. ExPASy Swiss-Prot
Match: Q09WX7 (30S ribosomal protein S19, chloroplastic OS=Morus indica OX=248361 GN=rps19 PE=3 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 1.2e-20 Identity = 43/49 (87.76%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of Cmc10g0261051 vs. ExPASy Swiss-Prot
Match: B1NWJ0 (30S ribosomal protein S19, chloroplastic OS=Manihot esculenta OX=3983 GN=rps19 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 2.1e-20 Identity = 43/49 (87.76%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of Cmc10g0261051 vs. ExPASy Swiss-Prot
Match: Q8LUX2 (30S ribosomal protein S19, chloroplastic OS=Phaseolus angularis OX=3914 GN=rps19 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 2.1e-20 Identity = 43/49 (87.76%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of Cmc10g0261051 vs. ExPASy TrEMBL
Match: A0A249RZE3 (Ribosomal protein S19 OS=Cucumis melo var. cantalupensis OX=3658 GN=rps19 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 5.7e-21 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 0
BLAST of Cmc10g0261051 vs. ExPASy TrEMBL
Match: A0A1S4EU53 (30S ribosomal protein S19, chloroplastic OS=Cucumis melo OX=3656 GN=rps19 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 5.7e-21 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 0
BLAST of Cmc10g0261051 vs. ExPASy TrEMBL
Match: A0A249RXL9 (Ribosomal protein S19 OS=Cucumis melo subsp. agrestis OX=217619 GN=rps19 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 5.7e-21 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 0
BLAST of Cmc10g0261051 vs. ExPASy TrEMBL
Match: A0A286NFU0 (Ribosomal protein S19 OS=Cucumis melo var. flexuosus OX=1120798 GN=rps19 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 5.7e-21 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 0
BLAST of Cmc10g0261051 vs. ExPASy TrEMBL
Match: A0A249RZ40 (Ribosomal protein S19 OS=Cucumis melo var. dudaim OX=2034236 GN=rps19 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 5.7e-21 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 0
BLAST of Cmc10g0261051 vs. TAIR 10
Match: ATCG00820.1 (ribosomal protein S19 ) HSP 1 Score: 92.4 bits (228), Expect = 1.1e-19 Identity = 41/49 (83.67%), Postives = 44/49 (89.80%), Query Frame = 0
BLAST of Cmc10g0261051 vs. TAIR 10
Match: AT5G47320.1 (ribosomal protein S19 ) HSP 1 Score: 43.9 bits (102), Expect = 4.3e-05 Identity = 19/41 (46.34%), Postives = 25/41 (60.98%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|