Cmc09g0240381 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGCTATGTTTTTAGTTCGAGGACGAAAAAGTCAAAAATTTCAACCAATTACAAATTTGCATCATTATCGTGTTGAAGTCTTCTATACTATCATTGATATGCAACTTCAAGAGTTGAATAATCATTTTACTGAATCAAGTACTGAATTGCTTCTCTGTATGACTTGTTTGAATCCGAGTAATTCATTTGCTGCTTTTGATAGACAAAAACTTAGTCGACTTGCTCAGTTTTATCCAAGAGACTTTTCAGCTATTGAACTCTTCATGCTTGAGGATCAACTTCAAAATTACATTATTGATATGCGTTCAGAGTTTGTTGAACTAAAAAACATTGGTGATCTTGCAATGAAAATAGTCATTACGAAAAGAGATAAGGTCTACCCGTTAGTTTATCGGTTGCTCACATTGGTGTTGATTTTACCAGTTGCAACAGCTACTGTAGAGAGAACATTTTCTGCTGTGAATATTGTGAAGACTCGACTGCGCAATCGAATGAAAAATCCAATGGATGAATAA ATGGATGCTATGTTTTTAGTTCGAGGACGAAAAAGTCAAAAATTTCAACCAATTACAAATTTGCATCATTATCGTGTTGAAGTCTTCTATACTATCATTGATATGCAACTTCAAGAGTTGAATAATCATTTTACTGAATCAAGTACTGAATTGCTTCTCTGTATGACTTGTTTGAATCCGAGTAATTCATTTGCTGCTTTTGATAGACAAAAACTTAGTCGACTTGCTCAGTTTTATCCAAGAGACTTTTCAGCTATTGAACTCTTCATGCTTGAGGATCAACTTCAAAATTACATTATTGATATGCGTTCAGAGTTTGTTGAACTAAAAAACATTGGTGATCTTGCAATGAAAATAGTCATTACGAAAAGAGATAAGGTCTACCCGTTAGTTTATCGGTTGCTCACATTGGTGTTGATTTTACCAGTTGCAACAGCTACTGTAGAGAGAACATTTTCTGCTGTGAATATTGTGAAGACTCGACTGCGCAATCGAATGAAAAATCCAATGGATGAATAA ATGGATGCTATGTTTTTAGTTCGAGGACGAAAAAGTCAAAAATTTCAACCAATTACAAATTTGCATCATTATCGTGTTGAAGTCTTCTATACTATCATTGATATGCAACTTCAAGAGTTGAATAATCATTTTACTGAATCAAGTACTGAATTGCTTCTCTGTATGACTTGTTTGAATCCGAGTAATTCATTTGCTGCTTTTGATAGACAAAAACTTAGTCGACTTGCTCAGTTTTATCCAAGAGACTTTTCAGCTATTGAACTCTTCATGCTTGAGGATCAACTTCAAAATTACATTATTGATATGCGTTCAGAGTTTGTTGAACTAAAAAACATTGGTGATCTTGCAATGAAAATAGTCATTACGAAAAGAGATAAGGTCTACCCGTTAGTTTATCGGTTGCTCACATTGGTGTTGATTTTACCAGTTGCAACAGCTACTGTAGAGAGAACATTTTCTGCTGTGAATATTGTGAAGACTCGACTGCGCAATCGAATGAAAAATCCAATGGATGAATAA MDAMFLVRGRKSQKFQPITNLHHYRVEVFYTIIDMQLQELNNHFTESSTELLLCMTCLNPSNSFAAFDRQKLSRLAQFYPRDFSAIELFMLEDQLQNYIIDMRSEFVELKNIGDLAMKIVITKRDKVYPLVYRLLTLVLILPVATATVERTFSAVNIVKTRLRNRMKNPMDE Homology
BLAST of Cmc09g0240381 vs. NCBI nr
Match: XP_008457138.1 (PREDICTED: uncharacterized protein LOC103496885 [Cucumis melo]) HSP 1 Score: 264.2 bits (674), Expect = 7.7e-67 Identity = 137/166 (82.53%), Postives = 154/166 (92.77%), Query Frame = 0
BLAST of Cmc09g0240381 vs. NCBI nr
Match: XP_031256830.1 (zinc finger MYM-type protein 1-like [Pistacia vera]) HSP 1 Score: 219.5 bits (558), Expect = 2.2e-53 Identity = 112/170 (65.88%), Postives = 139/170 (81.76%), Query Frame = 0
BLAST of Cmc09g0240381 vs. NCBI nr
Match: XP_024155975.1 (zinc finger MYM-type protein 1-like [Rosa chinensis]) HSP 1 Score: 219.5 bits (558), Expect = 2.2e-53 Identity = 113/168 (67.26%), Postives = 140/168 (83.33%), Query Frame = 0
BLAST of Cmc09g0240381 vs. NCBI nr
Match: XP_024172313.1 (zinc finger MYM-type protein 1-like [Rosa chinensis]) HSP 1 Score: 218.8 bits (556), Expect = 3.7e-53 Identity = 113/168 (67.26%), Postives = 139/168 (82.74%), Query Frame = 0
BLAST of Cmc09g0240381 vs. NCBI nr
Match: ESR65508.1 (hypothetical protein CICLE_v10007751mg [Citrus clementina]) HSP 1 Score: 216.5 bits (550), Expect = 1.8e-52 Identity = 112/168 (66.67%), Postives = 138/168 (82.14%), Query Frame = 0
BLAST of Cmc09g0240381 vs. ExPASy TrEMBL
Match: A0A1S3C638 (uncharacterized protein LOC103496885 OS=Cucumis melo OX=3656 GN=LOC103496885 PE=4 SV=1) HSP 1 Score: 264.2 bits (674), Expect = 3.7e-67 Identity = 137/166 (82.53%), Postives = 154/166 (92.77%), Query Frame = 0
BLAST of Cmc09g0240381 vs. ExPASy TrEMBL
Match: V4TY39 (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10007751mg PE=4 SV=1) HSP 1 Score: 216.5 bits (550), Expect = 8.9e-53 Identity = 112/168 (66.67%), Postives = 138/168 (82.14%), Query Frame = 0
BLAST of Cmc09g0240381 vs. ExPASy TrEMBL
Match: A0A6P5TKH2 (zinc finger MYM-type protein 1-like OS=Prunus avium OX=42229 GN=LOC110768262 PE=4 SV=1) HSP 1 Score: 215.7 bits (548), Expect = 1.5e-52 Identity = 114/168 (67.86%), Postives = 135/168 (80.36%), Query Frame = 0
BLAST of Cmc09g0240381 vs. ExPASy TrEMBL
Match: V4SXE8 (TTF-type domain-containing protein OS=Citrus clementina OX=85681 GN=CICLE_v10023986mg PE=4 SV=1) HSP 1 Score: 214.9 bits (546), Expect = 2.6e-52 Identity = 111/168 (66.07%), Postives = 137/168 (81.55%), Query Frame = 0
BLAST of Cmc09g0240381 vs. ExPASy TrEMBL
Match: V4UC77 (TTF-type domain-containing protein (Fragment) OS=Citrus clementina OX=85681 GN=CICLE_v10029993mg PE=4 SV=1) HSP 1 Score: 214.2 bits (544), Expect = 4.4e-52 Identity = 112/170 (65.88%), Postives = 137/170 (80.59%), Query Frame = 0
BLAST of Cmc09g0240381 vs. TAIR 10
Match: AT1G19260.1 (TTF-type zinc finger protein with HAT dimerisation domain ) HSP 1 Score: 162.9 bits (411), Expect = 2.2e-40 Identity = 87/162 (53.70%), Postives = 120/162 (74.07%), Query Frame = 0
BLAST of Cmc09g0240381 vs. TAIR 10
Match: AT3G29765.1 (General transcription factor 2-related zinc finger protein ) HSP 1 Score: 159.8 bits (403), Expect = 1.9e-39 Identity = 86/161 (53.42%), Postives = 119/161 (73.91%), Query Frame = 0
BLAST of Cmc09g0240381 vs. TAIR 10
Match: AT4G09660.1 (CONTAINS InterPro DOMAIN/s: Zinc finger, TTF-type (InterPro:IPR006580); BEST Arabidopsis thaliana protein match is: TTF-type zinc finger protein with HAT dimerisation domain (TAIR:AT1G19260.1); Has 839 Blast hits to 796 proteins in 42 species: Archae - 0; Bacteria - 0; Metazoa - 438; Fungi - 0; Plants - 401; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 148.3 bits (373), Expect = 5.7e-36 Identity = 79/151 (52.32%), Postives = 110/151 (72.85%), Query Frame = 0
BLAST of Cmc09g0240381 vs. TAIR 10
Match: AT2G06541.1 (TTF-type zinc finger protein with HAT dimerisation domain ) HSP 1 Score: 114.8 bits (286), Expect = 7.0e-26 Identity = 75/170 (44.12%), Postives = 110/170 (64.71%), Query Frame = 0
BLAST of Cmc09g0240381 vs. TAIR 10
Match: AT2G06541.2 (TTF-type zinc finger protein with HAT dimerisation domain ) HSP 1 Score: 114.8 bits (286), Expect = 7.0e-26 Identity = 75/170 (44.12%), Postives = 110/170 (64.71%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|