
Cmc08g0230741 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGAAATCAAGGCATTGTAGAAGATAAATCAGTGCTACTAAAGGGTATAAGTGGGGTTTTCAAGCCAGGTGTTTTAACTGCTCTTATGGGAGTGAGTGGGGTTGGTAAGACAACACTAATGGATGTGTTAGCTGGTAGAAAAACAGGTGGTTATATTGAAGGAAACATCAAAATATCTGGTTATCCCAAGAAGCAGGAAACATTTGCTAGAATCTTAGGTTACTGTGAACAAAATGACATCTCAATGGTCAAATTTTCAATCCAAACAACAATTAAAAGGACATTGACAATTTACAATACGAAGCAAATATACCTAAATATGCTAATGTAA ATGAGAAATCAAGGCATTGTAGAAGATAAATCAGTGCTACTAAAGGGTATAAGTGGGGTTTTCAAGCCAGGTGTTTTAACTGCTCTTATGGGAGTGAGTGGGGTTGGTAAGACAACACTAATGGATGTGTTAGCTGGTAGAAAAACAGGTGGTTATATTGAAGGAAACATCAAAATATCTGGTTATCCCAAGAAGCAGGAAACATTTGCTAGAATCTTAGGTTACTGTGAACAAAATGACATCTCAATGGTCAAATTTTCAATCCAAACAACAATTAAAAGGACATTGACAATTTACAATACGAAGCAAATATACCTAAATATGCTAATGTAA ATGAGAAATCAAGGCATTGTAGAAGATAAATCAGTGCTACTAAAGGGTATAAGTGGGGTTTTCAAGCCAGGTGTTTTAACTGCTCTTATGGGAGTGAGTGGGGTTGGTAAGACAACACTAATGGATGTGTTAGCTGGTAGAAAAACAGGTGGTTATATTGAAGGAAACATCAAAATATCTGGTTATCCCAAGAAGCAGGAAACATTTGCTAGAATCTTAGGTTACTGTGAACAAAATGACATCTCAATGGTCAAATTTTCAATCCAAACAACAATTAAAAGGACATTGACAATTTACAATACGAAGCAAATATACCTAAATATGCTAATGTAA MRNQGIVEDKSVLLKGISGVFKPGVLTALMGVSGVGKTTLMDVLAGRKTGGYIEGNIKISGYPKKQETFARILGYCEQNDISMVKFSIQTTIKRTLTIYNTKQIYLNMLM Homology
BLAST of Cmc08g0230741 vs. NCBI nr
Match: XP_008447485.1 (PREDICTED: pleiotropic drug resistance protein 1-like [Cucumis melo]) HSP 1 Score: 154.8 bits (390), Expect = 4.2e-34 Identity = 76/81 (93.83%), Postives = 78/81 (96.30%), Query Frame = 0
BLAST of Cmc08g0230741 vs. NCBI nr
Match: TYK20454.1 (pleiotropic drug resistance protein 1-like [Cucumis melo var. makuwa]) HSP 1 Score: 154.8 bits (390), Expect = 4.2e-34 Identity = 76/81 (93.83%), Postives = 78/81 (96.30%), Query Frame = 0
BLAST of Cmc08g0230741 vs. NCBI nr
Match: XP_038878862.1 (LOW QUALITY PROTEIN: pleiotropic drug resistance protein 1-like [Benincasa hispida]) HSP 1 Score: 153.3 bits (386), Expect = 1.2e-33 Identity = 75/81 (92.59%), Postives = 78/81 (96.30%), Query Frame = 0
BLAST of Cmc08g0230741 vs. NCBI nr
Match: XP_031739292.1 (pleiotropic drug resistance protein 1 [Cucumis sativus] >KAE8650759.1 hypothetical protein Csa_017543 [Cucumis sativus]) HSP 1 Score: 153.3 bits (386), Expect = 1.2e-33 Identity = 76/81 (93.83%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Cmc08g0230741 vs. NCBI nr
Match: XP_023524614.1 (pleiotropic drug resistance protein 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 151.8 bits (382), Expect = 3.6e-33 Identity = 74/81 (91.36%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Cmc08g0230741 vs. ExPASy Swiss-Prot
Match: Q7PC80 (ABC transporter G family member 34 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCG34 PE=3 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 3.7e-33 Identity = 72/96 (75.00%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of Cmc08g0230741 vs. ExPASy Swiss-Prot
Match: Q8GU89 (ABC transporter G family member 37 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCG37 PE=2 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 3.7e-33 Identity = 68/81 (83.95%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of Cmc08g0230741 vs. ExPASy Swiss-Prot
Match: Q8GU88 (ABC transporter G family member 39 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCG39 PE=3 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 4.8e-33 Identity = 66/81 (81.48%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of Cmc08g0230741 vs. ExPASy Swiss-Prot
Match: Q8GU92 (ABC transporter G family member 35 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCG35 PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 6.3e-33 Identity = 72/96 (75.00%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of Cmc08g0230741 vs. ExPASy Swiss-Prot
Match: Q76CU2 (Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum OX=4097 GN=PDR1 PE=2 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 6.3e-33 Identity = 68/81 (83.95%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of Cmc08g0230741 vs. ExPASy TrEMBL
Match: A0A5D3DAB8 (Pleiotropic drug resistance protein 1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold237G00220 PE=3 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 2.0e-34 Identity = 76/81 (93.83%), Postives = 78/81 (96.30%), Query Frame = 0
BLAST of Cmc08g0230741 vs. ExPASy TrEMBL
Match: A0A1S3BGZ4 (pleiotropic drug resistance protein 1-like OS=Cucumis melo OX=3656 GN=LOC103489921 PE=3 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 2.0e-34 Identity = 76/81 (93.83%), Postives = 78/81 (96.30%), Query Frame = 0
BLAST of Cmc08g0230741 vs. ExPASy TrEMBL
Match: A0A0A0L875 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G550680 PE=3 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 5.9e-34 Identity = 76/81 (93.83%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Cmc08g0230741 vs. ExPASy TrEMBL
Match: A0A6J1KCS8 (pleiotropic drug resistance protein 1-like OS=Cucurbita maxima OX=3661 GN=LOC111492704 PE=3 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 1.7e-33 Identity = 74/81 (91.36%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Cmc08g0230741 vs. ExPASy TrEMBL
Match: A0A6J1GAN7 (pleiotropic drug resistance protein 1-like OS=Cucurbita moschata OX=3662 GN=LOC111452288 PE=3 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 1.7e-33 Identity = 74/81 (91.36%), Postives = 77/81 (95.06%), Query Frame = 0
BLAST of Cmc08g0230741 vs. TAIR 10
Match: AT3G16340.1 (pleiotropic drug resistance 1 ) HSP 1 Score: 137.9 bits (346), Expect = 4.9e-33 Identity = 69/96 (71.88%), Postives = 81/96 (84.38%), Query Frame = 0
BLAST of Cmc08g0230741 vs. TAIR 10
Match: AT3G16340.2 (pleiotropic drug resistance 1 ) HSP 1 Score: 137.9 bits (346), Expect = 4.9e-33 Identity = 69/96 (71.88%), Postives = 81/96 (84.38%), Query Frame = 0
BLAST of Cmc08g0230741 vs. TAIR 10
Match: AT1G59870.1 (ABC-2 and Plant PDR ABC-type transporter family protein ) HSP 1 Score: 134.0 bits (336), Expect = 7.1e-32 Identity = 66/96 (68.75%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of Cmc08g0230741 vs. TAIR 10
Match: AT1G15520.1 (pleiotropic drug resistance 12 ) HSP 1 Score: 133.3 bits (334), Expect = 1.2e-31 Identity = 64/81 (79.01%), Postives = 70/81 (86.42%), Query Frame = 0
BLAST of Cmc08g0230741 vs. TAIR 10
Match: AT1G15210.1 (pleiotropic drug resistance 7 ) HSP 1 Score: 132.9 bits (333), Expect = 1.6e-31 Identity = 65/96 (67.71%), Postives = 78/96 (81.25%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|