Cmc08g0228461 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCAATTCTAAGCCTGTCACAACTTCGATTGAAACTGGGACCAAATTGTTCAAACATGAAGAAGGAGATGATGTTGATCCTTCATATTTCAAAAGTTTGGTTGGGAGTTTGAGATACTTGACTTGCACACGACTAGATATTCTTTTCAGTGTTGGATTGGTGAGTCAATTTATGGAATCTCCTACAACTACTCATTTGAAAGTGGCAAAGAGAATTCTTCGTTACCTGAAAGGTACGCTTGGCTCTGAGTTGTTTTATTTTTCATCTAAAGAATTCAAGCTTGAAGGCTATTGTGAGAGTGACTGGGCTGGAGATACTAATGATTGA ATGATCAATTCTAAGCCTGTCACAACTTCGATTGAAACTGGGACCAAATTGTTCAAACATGAAGAAGGAGATGATGTTGATCCTTCATATTTCAAAAGTTTGGTTGGGAGTTTGAGATACTTGACTTGCACACGACTAGATATTCTTTTCAGTGTTGGATTGGTGAGTCAATTTATGGAATCTCCTACAACTACTCATTTGAAAGTGGCAAAGAGAATTCTTCGTTACCTGAAAGGTACGCTTGGCTCTGAGTTGTTTTATTTTTCATCTAAAGAATTCAAGCTTGAAGGCTATTGTGAGAGTGACTGGGCTGGAGATACTAATGATTGA ATGATCAATTCTAAGCCTGTCACAACTTCGATTGAAACTGGGACCAAATTGTTCAAACATGAAGAAGGAGATGATGTTGATCCTTCATATTTCAAAAGTTTGGTTGGGAGTTTGAGATACTTGACTTGCACACGACTAGATATTCTTTTCAGTGTTGGATTGGTGAGTCAATTTATGGAATCTCCTACAACTACTCATTTGAAAGTGGCAAAGAGAATTCTTCGTTACCTGAAAGGTACGCTTGGCTCTGAGTTGTTTTATTTTTCATCTAAAGAATTCAAGCTTGAAGGCTATTGTGAGAGTGACTGGGCTGGAGATACTAATGATTGA MINSKPVTTSIETGTKLFKHEEGDDVDPSYFKSLVGSLRYLTCTRLDILFSVGLVSQFMESPTTTHLKVAKRILRYLKGTLGSELFYFSSKEFKLEGYCESDWAGDTND Homology
BLAST of Cmc08g0228461 vs. NCBI nr
Match: TYK05470.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 218.4 bits (555), Expect = 3.1e-53 Identity = 107/109 (98.17%), Postives = 107/109 (98.17%), Query Frame = 0
BLAST of Cmc08g0228461 vs. NCBI nr
Match: KAA0034928.1 (retrovirus-related pol polyprotein from transposon tnt 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 216.1 bits (549), Expect = 1.5e-52 Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 0
BLAST of Cmc08g0228461 vs. NCBI nr
Match: TYK18362.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 198.0 bits (502), Expect = 4.3e-47 Identity = 97/109 (88.99%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of Cmc08g0228461 vs. NCBI nr
Match: KAA0047979.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 198.0 bits (502), Expect = 4.3e-47 Identity = 97/109 (88.99%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of Cmc08g0228461 vs. NCBI nr
Match: TYK06895.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 198.0 bits (502), Expect = 4.3e-47 Identity = 97/109 (88.99%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of Cmc08g0228461 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 6.7e-19 Identity = 48/109 (44.04%), Postives = 64/109 (58.72%), Query Frame = 0
BLAST of Cmc08g0228461 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 2.5e-18 Identity = 45/109 (41.28%), Postives = 63/109 (57.80%), Query Frame = 0
BLAST of Cmc08g0228461 vs. ExPASy Swiss-Prot
Match: P92519 (Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana OX=3702 GN=AtMg00810 PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.5e-15 Identity = 42/112 (37.50%), Postives = 68/112 (60.71%), Query Frame = 0
BLAST of Cmc08g0228461 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 4.2e-13 Identity = 47/116 (40.52%), Postives = 68/116 (58.62%), Query Frame = 0
BLAST of Cmc08g0228461 vs. ExPASy Swiss-Prot
Match: P93290 (Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana OX=3702 GN=AtMg00240 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.8e-09 Identity = 26/65 (40.00%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of Cmc08g0228461 vs. ExPASy TrEMBL
Match: A0A5D3C291 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold83G001760 PE=4 SV=1) HSP 1 Score: 218.4 bits (555), Expect = 1.5e-53 Identity = 107/109 (98.17%), Postives = 107/109 (98.17%), Query Frame = 0
BLAST of Cmc08g0228461 vs. ExPASy TrEMBL
Match: A0A5A7SWD9 (Retrovirus-related pol polyprotein from transposon tnt 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold103G00600 PE=4 SV=1) HSP 1 Score: 216.1 bits (549), Expect = 7.4e-53 Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 0
BLAST of Cmc08g0228461 vs. ExPASy TrEMBL
Match: A0A5A7V3X9 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold313G003030 PE=4 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 2.1e-47 Identity = 97/109 (88.99%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of Cmc08g0228461 vs. ExPASy TrEMBL
Match: A0A5A7SJX6 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold139G002010 PE=4 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 2.1e-47 Identity = 97/109 (88.99%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of Cmc08g0228461 vs. ExPASy TrEMBL
Match: A0A5D3D497 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold456G00810 PE=4 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 2.1e-47 Identity = 97/109 (88.99%), Postives = 101/109 (92.66%), Query Frame = 0
BLAST of Cmc08g0228461 vs. TAIR 10
Match: ATMG00810.1 (DNA/RNA polymerases superfamily protein ) HSP 1 Score: 83.6 bits (205), Expect = 1.1e-16 Identity = 42/112 (37.50%), Postives = 68/112 (60.71%), Query Frame = 0
BLAST of Cmc08g0228461 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 80.5 bits (197), Expect = 9.3e-16 Identity = 38/103 (36.89%), Postives = 59/103 (57.28%), Query Frame = 0
BLAST of Cmc08g0228461 vs. TAIR 10
Match: ATMG00240.1 (Gag-Pol-related retrotransposon family protein ) HSP 1 Score: 62.8 bits (151), Expect = 2.0e-10 Identity = 26/65 (40.00%), Postives = 43/65 (66.15%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|