![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Cmc08g0225061 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGACCACTAATGTTACTTTCATTTTTTCCTTTTCACAGCCAAGGTTAAGTGGAAATCCTGGAATGACAATGGACTGGCAAGGTGCTCCTGCAAGCCCTAGTTCATTTACTGTAAAGAGGATTTTGCGTTTGGAAATTCCAATGGACACATATCCGAATGTAAATTCAATAAAGAAGTGTCTCTGTATGCGGTTTCTGAAATCCTTTCAGAATGTGGATTATTTAACACTTTAATTTGTCTTATTCCTTGGATGGCAGTTCAATTTTGTTGGACGGCTTCTTGGACCGAGAGGCAATTCTCTGAAGCGGGTAGAAGCTACTACAAGATGTCGTGTGTAA ATGACCACTAATGTTACTTTCATTTTTTCCTTTTCACAGCCAAGGTTAAGTGGAAATCCTGGAATGACAATGGACTGGCAAGGTGCTCCTGCAAGCCCTAGTTCATTTACTGTAAAGAGGATTTTGCGTTTGGAAATTCCAATGGACACATATCCGAATGTAAATTCAATAAAGAAGTGTCTCTGTATGCGGTTTCTGAAATCCTTTCAGAATTTCAATTTTGTTGGACGGCTTCTTGGACCGAGAGGCAATTCTCTGAAGCGGGTAGAAGCTACTACAAGATGTCGTGTGTAA ATGACCACTAATGTTACTTTCATTTTTTCCTTTTCACAGCCAAGGTTAAGTGGAAATCCTGGAATGACAATGGACTGGCAAGGTGCTCCTGCAAGCCCTAGTTCATTTACTGTAAAGAGGATTTTGCGTTTGGAAATTCCAATGGACACATATCCGAATGTAAATTCAATAAAGAAGTGTCTCTGTATGCGGTTTCTGAAATCCTTTCAGAATTTCAATTTTGTTGGACGGCTTCTTGGACCGAGAGGCAATTCTCTGAAGCGGGTAGAAGCTACTACAAGATGTCGTGTGTAA MTTNVTFIFSFSQPRLSGNPGMTMDWQGAPASPSSFTVKRILRLEIPMDTYPNVNSIKKCLCMRFLKSFQNFNFVGRLLGPRGNSLKRVEATTRCRV Homology
BLAST of Cmc08g0225061 vs. NCBI nr
Match: TYK24899.1 (KH domain-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 126.3 bits (316), Expect = 1.4e-25 Identity = 64/85 (75.29%), Postives = 66/85 (77.65%), Query Frame = 0
BLAST of Cmc08g0225061 vs. NCBI nr
Match: TYJ96583.1 (KH domain-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 126.3 bits (316), Expect = 1.4e-25 Identity = 64/85 (75.29%), Postives = 66/85 (77.65%), Query Frame = 0
BLAST of Cmc08g0225061 vs. NCBI nr
Match: XP_038905003.1 (KH domain-containing protein At2g38610-like isoform X2 [Benincasa hispida]) HSP 1 Score: 126.3 bits (316), Expect = 1.4e-25 Identity = 64/85 (75.29%), Postives = 66/85 (77.65%), Query Frame = 0
BLAST of Cmc08g0225061 vs. NCBI nr
Match: XP_004137670.3 (KH domain-containing protein At3g08620 [Cucumis sativus] >KGN58951.2 hypothetical protein Csa_001075 [Cucumis sativus]) HSP 1 Score: 126.3 bits (316), Expect = 1.4e-25 Identity = 64/85 (75.29%), Postives = 66/85 (77.65%), Query Frame = 0
BLAST of Cmc08g0225061 vs. NCBI nr
Match: XP_038905002.1 (KH domain-containing protein At3g08620-like isoform X1 [Benincasa hispida]) HSP 1 Score: 126.3 bits (316), Expect = 1.4e-25 Identity = 64/85 (75.29%), Postives = 66/85 (77.65%), Query Frame = 0
BLAST of Cmc08g0225061 vs. ExPASy Swiss-Prot
Match: Q9ZVI3 (KH domain-containing protein At2g38610 OS=Arabidopsis thaliana OX=3702 GN=At2g38610 PE=1 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.9e-26 Identity = 61/86 (70.93%), Postives = 63/86 (73.26%), Query Frame = 0
BLAST of Cmc08g0225061 vs. ExPASy Swiss-Prot
Match: Q8GYR4 (KH domain-containing protein At3g08620 OS=Arabidopsis thaliana OX=3702 GN=At3g08620 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 4.4e-22 Identity = 53/83 (63.86%), Postives = 59/83 (71.08%), Query Frame = 0
BLAST of Cmc08g0225061 vs. ExPASy Swiss-Prot
Match: Q75GR5 (KH domain-containing protein SPIN1 OS=Oryza sativa subsp. japonica OX=39947 GN=SPIN1 PE=1 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.0e-19 Identity = 49/85 (57.65%), Postives = 57/85 (67.06%), Query Frame = 0
BLAST of Cmc08g0225061 vs. ExPASy Swiss-Prot
Match: Q9FKT4 (KH domain-containing protein At5g56140 OS=Arabidopsis thaliana OX=3702 GN=At5g56140 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 8.3e-13 Identity = 40/86 (46.51%), Postives = 50/86 (58.14%), Query Frame = 0
BLAST of Cmc08g0225061 vs. ExPASy Swiss-Prot
Match: Q0WLR1 (KH domain-containing protein At4g26480 OS=Arabidopsis thaliana OX=3702 GN=At4g26480 PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.1e-12 Identity = 40/86 (46.51%), Postives = 51/86 (59.30%), Query Frame = 0
BLAST of Cmc08g0225061 vs. ExPASy TrEMBL
Match: A0A5D3DNL2 (KH domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold352G00100 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 6.8e-26 Identity = 64/85 (75.29%), Postives = 66/85 (77.65%), Query Frame = 0
BLAST of Cmc08g0225061 vs. ExPASy TrEMBL
Match: A0A5A7TS75 (KH domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold236G005970 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 6.8e-26 Identity = 64/85 (75.29%), Postives = 66/85 (77.65%), Query Frame = 0
BLAST of Cmc08g0225061 vs. ExPASy TrEMBL
Match: A0A5D3BBA5 (KH domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1243G00030 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 6.8e-26 Identity = 64/85 (75.29%), Postives = 66/85 (77.65%), Query Frame = 0
BLAST of Cmc08g0225061 vs. ExPASy TrEMBL
Match: A0A0A0LCK8 (KH domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G727970 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 6.8e-26 Identity = 64/85 (75.29%), Postives = 66/85 (77.65%), Query Frame = 0
BLAST of Cmc08g0225061 vs. ExPASy TrEMBL
Match: A0A5A7SID7 (KH domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold1220G00410 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 8.9e-26 Identity = 64/85 (75.29%), Postives = 66/85 (77.65%), Query Frame = 0
BLAST of Cmc08g0225061 vs. TAIR 10
Match: AT2G38610.1 (RNA-binding KH domain-containing protein ) HSP 1 Score: 119.0 bits (297), Expect = 2.1e-27 Identity = 61/86 (70.93%), Postives = 63/86 (73.26%), Query Frame = 0
BLAST of Cmc08g0225061 vs. TAIR 10
Match: AT2G38610.2 (RNA-binding KH domain-containing protein ) HSP 1 Score: 119.0 bits (297), Expect = 2.1e-27 Identity = 61/86 (70.93%), Postives = 63/86 (73.26%), Query Frame = 0
BLAST of Cmc08g0225061 vs. TAIR 10
Match: AT3G08620.1 (RNA-binding KH domain-containing protein ) HSP 1 Score: 105.1 bits (261), Expect = 3.1e-23 Identity = 53/83 (63.86%), Postives = 59/83 (71.08%), Query Frame = 0
BLAST of Cmc08g0225061 vs. TAIR 10
Match: AT5G56140.1 (RNA-binding KH domain-containing protein ) HSP 1 Score: 74.3 bits (181), Expect = 5.9e-14 Identity = 40/86 (46.51%), Postives = 50/86 (58.14%), Query Frame = 0
BLAST of Cmc08g0225061 vs. TAIR 10
Match: AT4G26480.1 (RNA-binding KH domain-containing protein ) HSP 1 Score: 73.9 bits (180), Expect = 7.7e-14 Identity = 40/86 (46.51%), Postives = 51/86 (59.30%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|