Cmc07g0196431 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGAATATTTTCTGGTGTTGAAGGAATTGCACGTATCGAGATTCAAAAAAGAATTGATCTTATTCAAGTGATAATCTTTATGGGATTCCCAAAGTTATTAATAGAAGGTGGGTCTCGAAAAATCGAAGAATTACAGATGAATGTACAAAAAGAATTAAATTCTGGGAACCGAAAACTTAACATTGCTATTACAAGAATAGGAAACCCTTATGGACACCCTAATATTCTCGCAGAATTTATAGCCGGACAATTAAAGAATAGAGTTTCATTTCGCAAAGCAATGAAAAAAGCTATTGAATTAACTGAACAGGCGGGTACAAAGGGAATTCAAGTACAAATTGCCGGACGTATAGACGGAAAAGAAATTGCACGTGTCGAATGGATCAGAGAAGGACGGGTTCCTCTACAAACCATTCGAGCTAAAATTGATTATTGTTGCTATCCAGTTCGAACTATCTATGGGGTATTAGGCATCAAAATTTGGATATTTGTAGACGAGCAATAA ATGAGAATATTTTCTGGTGTTGAAGGAATTGCACGTATCGAGATTCAAAAAAGAATTGATCTTATTCAAGTGATAATCTTTATGGGATTCCCAAAGTTATTAATAGAAGGTGGGTCTCGAAAAATCGAAGAATTACAGATGAATGTACAAAAAGAATTAAATTCTGGGAACCGAAAACTTAACATTGCTATTACAAGAATAGGAAACCCTTATGGACACCCTAATATTCTCGCAGAATTTATAGCCGGACAATTAAAGAATAGAGTTTCATTTCGCAAAGCAATGAAAAAAGCTATTGAATTAACTGAACAGGCGGGTACAAAGGGAATTCAAGTACAAATTGCCGGACGTATAGACGGAAAAGAAATTGCACGTGTCGAATGGATCAGAGAAGGACGGGTTCCTCTACAAACCATTCGAGCTAAAATTGATTATTGTTGCTATCCAGTTCGAACTATCTATGGGGTATTAGGCATCAAAATTTGGATATTTGTAGACGAGCAATAA ATGAGAATATTTTCTGGTGTTGAAGGAATTGCACGTATCGAGATTCAAAAAAGAATTGATCTTATTCAAGTGATAATCTTTATGGGATTCCCAAAGTTATTAATAGAAGGTGGGTCTCGAAAAATCGAAGAATTACAGATGAATGTACAAAAAGAATTAAATTCTGGGAACCGAAAACTTAACATTGCTATTACAAGAATAGGAAACCCTTATGGACACCCTAATATTCTCGCAGAATTTATAGCCGGACAATTAAAGAATAGAGTTTCATTTCGCAAAGCAATGAAAAAAGCTATTGAATTAACTGAACAGGCGGGTACAAAGGGAATTCAAGTACAAATTGCCGGACGTATAGACGGAAAAGAAATTGCACGTGTCGAATGGATCAGAGAAGGACGGGTTCCTCTACAAACCATTCGAGCTAAAATTGATTATTGTTGCTATCCAGTTCGAACTATCTATGGGGTATTAGGCATCAAAATTTGGATATTTGTAGACGAGCAATAA MRIFSGVEGIARIEIQKRIDLIQVIIFMGFPKLLIEGGSRKIEELQMNVQKELNSGNRKLNIAITRIGNPYGHPNILAEFIAGQLKNRVSFRKAMKKAIELTEQAGTKGIQVQIAGRIDGKEIARVEWIREGRVPLQTIRAKIDYCCYPVRTIYGVLGIKIWIFVDEQ Homology
BLAST of Cmc07g0196431 vs. NCBI nr
Match: AHM88937.1 (ribosomal protein S3 [Lagenaria siceraria]) HSP 1 Score: 332.8 bits (852), Expect = 1.7e-87 Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 0
BLAST of Cmc07g0196431 vs. NCBI nr
Match: YP_009317424.1 (ribosomal protein S3 [Coccinia grandis] >AOX48751.1 ribosomal protein S3 [Coccinia grandis] >AOX48836.1 ribosomal protein S3 [Coccinia grandis]) HSP 1 Score: 332.8 bits (852), Expect = 1.7e-87 Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 0
BLAST of Cmc07g0196431 vs. NCBI nr
Match: YP_004841822.1 (ribosomal protein S3 [Cucumis melo subsp. melo] >YP_009860112.1 ribosomal protein S3 [Cucumis melo subsp. agrestis] >ASY96586.1 ribosomal protein S3 [Cucumis melo var. conomon] >ASY96673.1 ribosomal protein S3 [Cucumis melo var. makuwa] >ASY96760.1 ribosomal protein S3 [Cucumis melo var. momordica] >ASY96847.1 ribosomal protein S3 [Cucumis melo var. dudaim] >ASY96934.1 ribosomal protein S3 [Cucumis melo var. cantalupo] >ASY97108.1 ribosomal protein S3 [Cucumis melo var. inodorus] >ASY97282.1 ribosomal protein S3 [Cucumis melo var. flexuosus] >QJF46423.1 ribosomal protein S3 [Cucumis melo]) HSP 1 Score: 332.8 bits (852), Expect = 1.7e-87 Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 0
BLAST of Cmc07g0196431 vs. NCBI nr
Match: YP_009456184.1 (ribosomal protein S3 [Lagenaria siceraria] >YP_010131132.1 ribosomal protein S3 [Benincasa hispida] >QNM38569.1 ribosomal protein S3 [Lagenaria siceraria var. microcarpa] >AHM88705.1 ribosomal protein S3 [Lagenaria siceraria] >AHM88995.1 ribosomal protein S3 [Lagenaria siceraria] >AHM89054.1 ribosomal protein S3 [Lagenaria siceraria] >AHM89113.1 ribosomal protein S3 [Lagenaria siceraria]) HSP 1 Score: 332.8 bits (852), Expect = 1.7e-87 Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 0
BLAST of Cmc07g0196431 vs. NCBI nr
Match: YP_009326028.1 (ribosomal protein S3 [Citrullus lanatus] >YP_009348070.1 ribosomal protein S3 [Citrullus mucosospermus] >YP_009420833.1 ribosomal protein S3 [Citrullus colocynthis] >YP_009431595.1 ribosomal protein S3 [Citrullus amarus] >YP_009431681.1 ribosomal protein S3 [Citrullus rehmii] >APW82501.1 ribosomal protein S3 [Citrullus lanatus subsp. vulgaris] >QZL38720.1 ribosomal protein S3 [Citrullus ecirrhosus] >APD52519.1 ribosomal protein S3 [Citrullus lanatus] >APW82586.1 ribosomal protein S3 [Citrullus lanatus subsp. vulgaris] >APW82671.1 ribosomal protein S3 [Citrullus lanatus subsp. vulgaris]) HSP 1 Score: 332.4 bits (851), Expect = 2.2e-87 Identity = 167/168 (99.40%), Postives = 168/168 (100.00%), Query Frame = 0
BLAST of Cmc07g0196431 vs. ExPASy Swiss-Prot
Match: Q4VZN0 (30S ribosomal protein S3, chloroplastic OS=Cucumis sativus OX=3659 GN=rps3 PE=3 SV=1) HSP 1 Score: 324.3 bits (830), Expect = 8.0e-88 Identity = 162/168 (96.43%), Postives = 166/168 (98.81%), Query Frame = 0
BLAST of Cmc07g0196431 vs. ExPASy Swiss-Prot
Match: Q0ZIY0 (30S ribosomal protein S3, chloroplastic OS=Vitis vinifera OX=29760 GN=rps3 PE=3 SV=1) HSP 1 Score: 295.4 bits (755), Expect = 4.0e-79 Identity = 151/168 (89.88%), Postives = 158/168 (94.05%), Query Frame = 0
BLAST of Cmc07g0196431 vs. ExPASy Swiss-Prot
Match: A0ZZ73 (30S ribosomal protein S3, chloroplastic OS=Gossypium barbadense OX=3634 GN=rps3 PE=3 SV=1) HSP 1 Score: 295.0 bits (754), Expect = 5.2e-79 Identity = 149/167 (89.22%), Postives = 157/167 (94.01%), Query Frame = 0
BLAST of Cmc07g0196431 vs. ExPASy Swiss-Prot
Match: Q2L946 (30S ribosomal protein S3, chloroplastic OS=Gossypium hirsutum OX=3635 GN=rps3 PE=3 SV=1) HSP 1 Score: 295.0 bits (754), Expect = 5.2e-79 Identity = 149/167 (89.22%), Postives = 157/167 (94.01%), Query Frame = 0
BLAST of Cmc07g0196431 vs. ExPASy Swiss-Prot
Match: A4QJF3 (30S ribosomal protein S3, chloroplastic OS=Aethionema cordifolium OX=434059 GN=rps3 PE=3 SV=1) HSP 1 Score: 294.3 bits (752), Expect = 8.9e-79 Identity = 150/168 (89.29%), Postives = 156/168 (92.86%), Query Frame = 0
BLAST of Cmc07g0196431 vs. ExPASy TrEMBL
Match: A0A1S4EU44 (30S ribosomal protein S3, chloroplastic OS=Cucumis melo OX=3656 GN=rps3 PE=3 SV=1) HSP 1 Score: 332.8 bits (852), Expect = 8.3e-88 Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 0
BLAST of Cmc07g0196431 vs. ExPASy TrEMBL
Match: A0A249RZG7 (30S ribosomal protein S3, chloroplastic OS=Cucumis melo var. cantalupensis OX=3658 GN=rps3 PE=3 SV=1) HSP 1 Score: 332.8 bits (852), Expect = 8.3e-88 Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 0
BLAST of Cmc07g0196431 vs. ExPASy TrEMBL
Match: A0A2Z2CGI2 (30S ribosomal protein S3, chloroplastic OS=Coccinia grandis OX=387127 GN=rps3 PE=3 SV=1) HSP 1 Score: 332.8 bits (852), Expect = 8.3e-88 Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 0
BLAST of Cmc07g0196431 vs. ExPASy TrEMBL
Match: X2EZ87 (30S ribosomal protein S3, chloroplastic OS=Lagenaria siceraria OX=3668 GN=rps3 PE=3 SV=1) HSP 1 Score: 332.8 bits (852), Expect = 8.3e-88 Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 0
BLAST of Cmc07g0196431 vs. ExPASy TrEMBL
Match: A0A249RXQ1 (30S ribosomal protein S3, chloroplastic OS=Cucumis melo subsp. agrestis OX=217619 GN=rps3 PE=3 SV=1) HSP 1 Score: 332.8 bits (852), Expect = 8.3e-88 Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 0
BLAST of Cmc07g0196431 vs. TAIR 10
Match: ATCG00800.1 (structural constituent of ribosome ) HSP 1 Score: 292.7 bits (748), Expect = 1.8e-79 Identity = 149/168 (88.69%), Postives = 156/168 (92.86%), Query Frame = 0
BLAST of Cmc07g0196431 vs. TAIR 10
Match: ATMG00090.1 (structural constituent of ribosome;protein binding ) HSP 1 Score: 52.8 bits (125), Expect = 3.2e-07 Identity = 36/112 (32.14%), Postives = 57/112 (50.89%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|