Cmc07g0186691 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCGGGTAATTTCTTGGTCCTTTGCCGGTACGTGTGGAATCAAAAGTACAAGAAAAGGGACACCATTTGCGGCTCAAATCGCAACAGGATATGCTATTCGAGCAGTAGTGGATCAAGGGATGCAACGAGCTGAAGTTATGATAAAGGGCCTTGGTCTCAGAAGAGATGCAACATTAAGAGCTATTCCAAGAAGTTGA ATGGGTCGGGTAATTTCTTGGTCCTTTGCCGGTACGTGTGGAATCAAAAGTACAAGAAAAGGGACACCATTTGCGGCTCAAATCGCAACAGGATATGCTATTCGAGCAGTAGTGGATCAAGGGATGCAACGAGCTGAAGTTATGATAAAGGGCCTTGGTCTCAGAAGAGATGCAACATTAAGAGCTATTCCAAGAAGTTGA ATGGGTCGGGTAATTTCTTGGTCCTTTGCCGGTACGTGTGGAATCAAAAGTACAAGAAAAGGGACACCATTTGCGGCTCAAATCGCAACAGGATATGCTATTCGAGCAGTAGTGGATCAAGGGATGCAACGAGCTGAAGTTATGATAAAGGGCCTTGGTCTCAGAAGAGATGCAACATTAAGAGCTATTCCAAGAAGTTGA MGRVISWSFAGTCGIKSTRKGTPFAAQIATGYAIRAVVDQGMQRAEVMIKGLGLRRDATLRAIPRS Homology
BLAST of Cmc07g0186691 vs. NCBI nr
Match: TYH97719.1 (hypothetical protein ES332_A12G260900v1 [Gossypium tomentosum]) HSP 1 Score: 107.1 bits (266), Expect = 6.0e-20 Identity = 55/65 (84.62%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Cmc07g0186691 vs. NCBI nr
Match: YP_009993714.1 (ribosomal protein S11 [Phaleria macrocarpa] >QNO35464.1 ribosomal protein S11 [Phaleria macrocarpa]) HSP 1 Score: 105.9 bits (263), Expect = 1.3e-19 Identity = 54/65 (83.08%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Cmc07g0186691 vs. NCBI nr
Match: YP_010017027.1 (ribosomal protein S11 [Sterculia monosperma] >YP_010039498.1 ribosomal protein S11 [Sterculia lanceolata] >QOJ45770.1 ribosomal protein S11 [Sterculia monosperma] >QOY45824.1 ribosomal protein S11 [Sterculia lanceolata] >QOY45907.1 ribosomal protein S11 [Sterculia monosperma]) HSP 1 Score: 105.5 bits (262), Expect = 1.8e-19 Identity = 54/65 (83.08%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Cmc07g0186691 vs. NCBI nr
Match: YP_009650502.1 (ribosomal protein S11 [Stellera chamaejasme] >YP_009679721.1 ribosomal protein S11 [Daphne giraldii] >QOJ46119.1 ribosomal protein S11 [Stellera chamaejasme f. chrysantha] >QSQ86704.1 ribosomal protein S11 [Wikstroemia canescens] >QSQ86882.1 ribosomal protein S11 [Wikstroemia alternifolia] >QCF39776.1 ribosomal protein S11 [Stellera chamaejasme] >QDP70037.1 ribosomal protein S11 [Daphne giraldii]) HSP 1 Score: 104.8 bits (260), Expect = 3.0e-19 Identity = 54/65 (83.08%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Cmc07g0186691 vs. NCBI nr
Match: YP_009663853.1 (ribosomal protein S11 [Daphne tangutica] >YP_010129297.1 30S ribosomal protein S11 [Daphne acutiloba] >YP_010129554.1 30S ribosomal protein S11 [Daphne feddei] >YP_010151088.1 ribosomal protein S11 [Daphne retusa] >YP_010151179.1 ribosomal protein S11 [Daphne depauperata] >QCW07886.1 ribosomal protein S11 [Daphne tangutica] >QPZ48523.1 30S ribosomal protein S11 [Daphne acutiloba] >QPZ48863.1 30S ribosomal protein S11 [Daphne feddei] >QPZ49113.1 30S ribosomal protein S11 [Daphne acutiloba] >QPZ49370.1 30S ribosomal protein S11 [Daphne feddei]) HSP 1 Score: 104.8 bits (260), Expect = 3.0e-19 Identity = 54/65 (83.08%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Cmc07g0186691 vs. ExPASy Swiss-Prot
Match: A0ZZ68 (30S ribosomal protein S11, chloroplastic OS=Gossypium barbadense OX=3634 GN=rps11 PE=3 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 6.7e-22 Identity = 54/65 (83.08%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of Cmc07g0186691 vs. ExPASy Swiss-Prot
Match: Q2L937 (30S ribosomal protein S11, chloroplastic OS=Gossypium hirsutum OX=3635 GN=rps11 PE=3 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 6.7e-22 Identity = 54/65 (83.08%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of Cmc07g0186691 vs. ExPASy Swiss-Prot
Match: Q6EW19 (30S ribosomal protein S11, chloroplastic OS=Nymphaea alba OX=34301 GN=rps11 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 8.7e-22 Identity = 53/65 (81.54%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of Cmc07g0186691 vs. ExPASy Swiss-Prot
Match: B1A968 (30S ribosomal protein S11, chloroplastic OS=Carica papaya OX=3649 GN=rps11 PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.5e-21 Identity = 53/65 (81.54%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of Cmc07g0186691 vs. ExPASy Swiss-Prot
Match: Q4VZK2 (30S ribosomal protein S11, chloroplastic OS=Cucumis sativus OX=3659 GN=rps11 PE=3 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 1.9e-21 Identity = 53/65 (81.54%), Postives = 54/65 (83.08%), Query Frame = 0
BLAST of Cmc07g0186691 vs. ExPASy TrEMBL
Match: A0A5D2N4W1 (Uncharacterized protein OS=Gossypium tomentosum OX=34277 GN=ES332_A12G260900v1 PE=3 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 2.9e-20 Identity = 55/65 (84.62%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Cmc07g0186691 vs. ExPASy TrEMBL
Match: A0A7G9XJA6 (30S ribosomal protein S11, chloroplastic OS=Phaleria macrocarpa OX=223762 GN=rps11 PE=3 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 6.5e-20 Identity = 54/65 (83.08%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Cmc07g0186691 vs. ExPASy TrEMBL
Match: A0A7L9CVM2 (30S ribosomal protein S11, chloroplastic OS=Sterculia monosperma OX=1679389 GN=rps11 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 8.5e-20 Identity = 54/65 (83.08%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Cmc07g0186691 vs. ExPASy TrEMBL
Match: A0A7T3U2S3 (30S ribosomal protein S11 OS=Daphne acutiloba OX=2753872 GN=rps11 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 1.4e-19 Identity = 54/65 (83.08%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Cmc07g0186691 vs. ExPASy TrEMBL
Match: A0A7T3P9C0 (30S ribosomal protein S11 OS=Daphne feddei OX=2753873 GN=rps11 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 1.4e-19 Identity = 54/65 (83.08%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Cmc07g0186691 vs. TAIR 10
Match: ATCG00750.1 (ribosomal protein S11 ) HSP 1 Score: 100.5 bits (249), Expect = 5.2e-22 Identity = 52/65 (80.00%), Postives = 54/65 (83.08%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|