Cmc07g0186471 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCATATACATCACACATCCTAGATCAACTAAAGACTCTGGGGTTCCAGCAGGCCACTGCTACATCCATTTCATTAGGAATTTATGATCTTTTAACAATCCCTTCTAAGGGATGGCTAGTCCAAGATGCTGAACAACAAAGTTTGATTTTGGAAAAACACCATCATTATGGAAACGTACACGCAGTAGAAAAATTACGCCAGTCCATTGAGATATGA ATGGCATATACATCACACATCCTAGATCAACTAAAGACTCTGGGGTTCCAGCAGGCCACTGCTACATCCATTTCATTAGGAATTTATGATCTTTTAACAATCCCTTCTAAGGGATGGCTAGTCCAAGATGCTGAACAACAAAGTTTGATTTTGGAAAAACACCATCATTATGGAAACGTACACGCAGTAGAAAAATTACGCCAGTCCATTGAGATATGA ATGGCATATACATCACACATCCTAGATCAACTAAAGACTCTGGGGTTCCAGCAGGCCACTGCTACATCCATTTCATTAGGAATTTATGATCTTTTAACAATCCCTTCTAAGGGATGGCTAGTCCAAGATGCTGAACAACAAAGTTTGATTTTGGAAAAACACCATCATTATGGAAACGTACACGCAGTAGAAAAATTACGCCAGTCCATTGAGATATGA MAYTSHILDQLKTLGFQQATATSISLGIYDLLTIPSKGWLVQDAEQQSLILEKHHHYGNVHAVEKLRQSIEI Homology
BLAST of Cmc07g0186471 vs. NCBI nr
Match: YP_004841773.1 (RNA polymerase beta'' subunit [Cucumis melo subsp. melo] >YP_009860063.1 RNA polymerase beta'' subunit [Cucumis melo subsp. agrestis] >ASY96578.1 RNA polymerase beta'' subunit [Cucumis melo var. conomon] >ASY96665.1 RNA polymerase beta'' subunit [Cucumis melo var. makuwa] >ASY96839.1 RNA polymerase beta'' subunit [Cucumis melo var. dudaim] >ASY97100.1 RNA polymerase beta'' subunit [Cucumis melo var. inodorus] >AEM76882.1 RNA polymerase beta'' subunit [Cucumis melo subsp. melo]) HSP 1 Score: 142.1 bits (357), Expect = 1.8e-30 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. NCBI nr
Match: AUF34037.1 (RpoC2 [Mastixia caudatilimba]) HSP 1 Score: 142.1 bits (357), Expect = 1.8e-30 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. NCBI nr
Match: APW82621.1 (RNA polymerase beta'' subunit [Citrullus lanatus subsp. vulgaris]) HSP 1 Score: 142.1 bits (357), Expect = 1.8e-30 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. NCBI nr
Match: QJF46373.1 (RNA polymerase beta'' subunit [Cucumis melo] >QRW36545.1 RNA polymerase beta'' subunit [Cucumis melo]) HSP 1 Score: 142.1 bits (357), Expect = 1.8e-30 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. NCBI nr
Match: QJR52946.1 (RNA polymerase beta'' subunit [Herpetospermum pedunculosum]) HSP 1 Score: 142.1 bits (357), Expect = 1.8e-30 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. ExPASy Swiss-Prot
Match: Q4VZP3 (DNA-directed RNA polymerase subunit beta'' OS=Cucumis sativus OX=3659 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 2.4e-33 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. ExPASy Swiss-Prot
Match: P11704 (DNA-directed RNA polymerase subunit beta'' OS=Spinacia oleracea OX=3562 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 2.4e-33 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. ExPASy Swiss-Prot
Match: Q09FX1 (DNA-directed RNA polymerase subunit beta'' OS=Nandina domestica OX=41776 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 4.1e-33 Identity = 70/72 (97.22%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. ExPASy Swiss-Prot
Match: A4QJA5 (DNA-directed RNA polymerase subunit beta'' OS=Aethionema cordifolium OX=434059 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 5.4e-33 Identity = 70/72 (97.22%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. ExPASy Swiss-Prot
Match: A4QJI9 (DNA-directed RNA polymerase subunit beta'' OS=Aethionema grandiflorum OX=72657 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 5.4e-33 Identity = 70/72 (97.22%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. ExPASy TrEMBL
Match: A0A218KG46 (DNA-directed RNA polymerase subunit beta'' OS=Cucumis sativus var. hardwickii OX=319220 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 8.9e-31 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. ExPASy TrEMBL
Match: A0A1X9Q1J9 (DNA-directed RNA polymerase subunit beta'' OS=Cucumis sativus OX=3659 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 8.9e-31 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. ExPASy TrEMBL
Match: A0A249RZW9 (DNA-directed RNA polymerase subunit beta'' OS=Cucumis melo var. cantalupensis OX=3658 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 8.9e-31 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. ExPASy TrEMBL
Match: A0A1P8LFL6 (DNA-directed RNA polymerase OS=Citrullus mucosospermus OX=519315 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 8.9e-31 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. ExPASy TrEMBL
Match: A0A249RXP5 (DNA-directed RNA polymerase subunit beta'' OS=Cucumis melo subsp. agrestis OX=217619 GN=rpoC2 PE=3 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 8.9e-31 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 0
BLAST of Cmc07g0186471 vs. TAIR 10
Match: ATCG00170.1 (DNA-directed RNA polymerase family protein ) HSP 1 Score: 138.7 bits (348), Expect = 1.9e-33 Identity = 69/72 (95.83%), Postives = 70/72 (97.22%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|