Cmc07g0185251 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTTGTGTATGGTTCTAAGGATCTGATCCTTACTGGATACACTGACTCCGATTTTCAAACTGATAAAGATGCTAGAAAGTCTACATCAGGATCAGTTTCCACTTTGAACGGAGGAGCAGTAGTATGGAGAAGCATAAAACAATCTTGTATTGCCGACTCCACTATGGAAGCTGAATATGTAGCTGCCTGTGAAGCAACAAAGGAAGTAGTATGGCTTAAAAAGTTCTTAACCGATTTGGAAGTTGTTCCAAATATGCATTTGCCAATCACCTTGTATTGTGACAACAGTGGTGCAGTTGCAAATTCGCGAGAACCTAGAAGTCACAAACGTGGAAAGCACATTGAATGA ATGCTTGTGTATGGTTCTAAGGATCTGATCCTTACTGGATACACTGACTCCGATTTTCAAACTGATAAAGATGCTAGAAAGTCTACATCAGGATCAGTTTCCACTTTGAACGGAGGAGCAGTAGTATGGAGAAGCATAAAACAATCTTGTATTGCCGACTCCACTATGGAAGCTGAATATGTAGCTGCCTGTGAAGCAACAAAGGAAGTAGTATGGCTTAAAAAGTTCTTAACCGATTTGGAAGTTGTTCCAAATATGCATTTGCCAATCACCTTGTATTGTGACAACAGTGGTGCAGTTGCAAATTCGCGAGAACCTAGAAGTCACAAACGTGGAAAGCACATTGAATGA ATGCTTGTGTATGGTTCTAAGGATCTGATCCTTACTGGATACACTGACTCCGATTTTCAAACTGATAAAGATGCTAGAAAGTCTACATCAGGATCAGTTTCCACTTTGAACGGAGGAGCAGTAGTATGGAGAAGCATAAAACAATCTTGTATTGCCGACTCCACTATGGAAGCTGAATATGTAGCTGCCTGTGAAGCAACAAAGGAAGTAGTATGGCTTAAAAAGTTCTTAACCGATTTGGAAGTTGTTCCAAATATGCATTTGCCAATCACCTTGTATTGTGACAACAGTGGTGCAGTTGCAAATTCGCGAGAACCTAGAAGTCACAAACGTGGAAAGCACATTGAATGA MLVYGSKDLILTGYTDSDFQTDKDARKSTSGSVSTLNGGAVVWRSIKQSCIADSTMEAEYVAACEATKEVVWLKKFLTDLEVVPNMHLPITLYCDNSGAVANSREPRSHKRGKHIE Homology
BLAST of Cmc07g0185251 vs. NCBI nr
Match: KAA0066714.1 (gag/pol protein [Cucumis melo var. makuwa] >TYK27862.1 gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 233.0 bits (593), Expect = 1.3e-57 Identity = 115/116 (99.14%), Postives = 115/116 (99.14%), Query Frame = 0
BLAST of Cmc07g0185251 vs. NCBI nr
Match: KAA0059674.1 (retrovirus-related pol polyprotein from transposon tnt 1-94 [Cucumis melo var. makuwa] >TYK26113.1 retrovirus-related pol polyprotein from transposon tnt 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 223.4 bits (568), Expect = 1.0e-54 Identity = 108/116 (93.10%), Postives = 112/116 (96.55%), Query Frame = 0
BLAST of Cmc07g0185251 vs. NCBI nr
Match: TYK06386.1 (gag/pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 222.6 bits (566), Expect = 1.7e-54 Identity = 110/116 (94.83%), Postives = 110/116 (94.83%), Query Frame = 0
BLAST of Cmc07g0185251 vs. NCBI nr
Match: ADJ18449.1 (gag/pol protein, partial [Bryonia dioica]) HSP 1 Score: 222.6 bits (566), Expect = 1.7e-54 Identity = 107/116 (92.24%), Postives = 113/116 (97.41%), Query Frame = 0
BLAST of Cmc07g0185251 vs. NCBI nr
Match: KAA0041899.1 (retrovirus-related pol polyprotein from transposon tnt 1-94 [Cucumis melo var. makuwa] >TYK17833.1 retrovirus-related pol polyprotein from transposon tnt 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 222.6 bits (566), Expect = 1.7e-54 Identity = 108/116 (93.10%), Postives = 111/116 (95.69%), Query Frame = 0
BLAST of Cmc07g0185251 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.4e-21 Identity = 52/115 (45.22%), Postives = 74/115 (64.35%), Query Frame = 0
BLAST of Cmc07g0185251 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 77.0 bits (188), Expect = 1.5e-13 Identity = 40/107 (37.38%), Postives = 63/107 (58.88%), Query Frame = 0
BLAST of Cmc07g0185251 vs. ExPASy Swiss-Prot
Match: P0CV72 (Secreted RxLR effector protein 161 OS=Plasmopara viticola OX=143451 GN=RXLR161 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 9.3e-11 Identity = 34/63 (53.97%), Postives = 45/63 (71.43%), Query Frame = 0
BLAST of Cmc07g0185251 vs. ExPASy TrEMBL
Match: A0A5A7VHA0 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold384G00410 PE=4 SV=1) HSP 1 Score: 233.0 bits (593), Expect = 6.2e-58 Identity = 115/116 (99.14%), Postives = 115/116 (99.14%), Query Frame = 0
BLAST of Cmc07g0185251 vs. ExPASy TrEMBL
Match: A0A5A7UX57 (Retrovirus-related pol polyprotein from transposon tnt 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold111G00250 PE=4 SV=1) HSP 1 Score: 223.4 bits (568), Expect = 4.9e-55 Identity = 108/116 (93.10%), Postives = 112/116 (96.55%), Query Frame = 0
BLAST of Cmc07g0185251 vs. ExPASy TrEMBL
Match: A0A5A7TKJ0 (Retrovirus-related pol polyprotein from transposon tnt 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold306G00900 PE=4 SV=1) HSP 1 Score: 222.6 bits (566), Expect = 8.4e-55 Identity = 108/116 (93.10%), Postives = 111/116 (95.69%), Query Frame = 0
BLAST of Cmc07g0185251 vs. ExPASy TrEMBL
Match: A0A5D3C7T2 (Gag/pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold163G00810 PE=4 SV=1) HSP 1 Score: 222.6 bits (566), Expect = 8.4e-55 Identity = 110/116 (94.83%), Postives = 110/116 (94.83%), Query Frame = 0
BLAST of Cmc07g0185251 vs. ExPASy TrEMBL
Match: E2GK51 (Gag/pol protein (Fragment) OS=Bryonia dioica OX=3652 PE=4 SV=1) HSP 1 Score: 222.6 bits (566), Expect = 8.4e-55 Identity = 107/116 (92.24%), Postives = 113/116 (97.41%), Query Frame = 0
BLAST of Cmc07g0185251 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 77.0 bits (188), Expect = 1.1e-14 Identity = 43/116 (37.07%), Postives = 69/116 (59.48%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|