
Cmc05g0128341 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTTTCAAAGTTCTTGTTTTTGATACTCTCCATTGATCGTTTCAACCTCCTCTCTCCCTCAGCCGCAAGGAGTAGCAATTTTCCCATACACAAAATTTGAATCTTCTTGTGTTTGTATATTCATACGTATGCTCTAATATAACTTAATTTCCTTACTGTTTTCAAGACTAATACAATTACTGAATCGGTTTAATATGGAAAAGGGTAGGCGAAGATGAAGGTGGCGGTGATCGGAGCTGGGATCAACGGTCTGATTTCTGCTTATGTTGTAGCCAAAGCTGGAGTAGAGGTGGTGTTGTTTGAGAAGGAAGAGTACTTAGGCAGCCATCATTTTAGAACAATAAATTTTGATGGCTTTGATTTGGACCTCGGCATCATGCTCTTCAATCCAGTTATTATCTCTTTCTCACTTCTTTTAGGTTTAGTTTGA TTTTCAAAGTTCTTGTTTTTGATACTCTCCATTGATCGTTTCAACCTCCTCTCTCCCTCAGCCGCAAGGAGTAGCAATTTTCCCATACACAAAATTTGAATCTTCTTGTGTTTGTATATTCATACGGTAGGCGAAGATGAAGGTGGCGGTGATCGGAGCTGGGATCAACGGTCTGATTTCTGCTTATGTTGTAGCCAAAGCTGGAGTAGAGGTGGTGTTGTTTGAGAAGGAAGAGTACTTAGGCAGCCATCATTTTAGAACAATAAATTTTGATGGCTTTGATTTGGACCTCGGCATCATGCTCTTCAATCCAGTTATTATCTCTTTCTCACTTCTTTTAGGTTTAGTTTGA ATGAAGGTGGCGGTGATCGGAGCTGGGATCAACGGTCTGATTTCTGCTTATGTTGTAGCCAAAGCTGGAGTAGAGGTGGTGTTGTTTGAGAAGGAAGAGTACTTAGGCAGCCATCATTTTAGAACAATAAATTTTGATGGCTTTGATTTGGACCTCGGCATCATGCTCTTCAATCCAGTTATTATCTCTTTCTCACTTCTTTTAGGTTTAGTTTGA MKVAVIGAGINGLISAYVVAKAGVEVVLFEKEEYLGSHHFRTINFDGFDLDLGIMLFNPVIISFSLLLGLV Homology
BLAST of Cmc05g0128341 vs. NCBI nr
Match: KAA0050737.1 (Mycolic acid cyclopropane synthase [Cucumis melo var. makuwa]) HSP 1 Score: 119.0 bits (297), Expect = 1.6e-23 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of Cmc05g0128341 vs. NCBI nr
Match: KAA0050723.1 (Mycolic acid cyclopropane synthase [Cucumis melo var. makuwa]) HSP 1 Score: 119.0 bits (297), Expect = 1.6e-23 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of Cmc05g0128341 vs. NCBI nr
Match: TYJ95687.1 (Cyclopropane-fatty-acyl-phospholipid synthase isoform 5 [Cucumis melo var. makuwa]) HSP 1 Score: 119.0 bits (297), Expect = 1.6e-23 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of Cmc05g0128341 vs. NCBI nr
Match: XP_031736387.1 (uncharacterized protein LOC101213610 isoform X2 [Cucumis sativus]) HSP 1 Score: 100.9 bits (250), Expect = 4.6e-18 Identity = 49/60 (81.67%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of Cmc05g0128341 vs. NCBI nr
Match: KAE8651803.1 (hypothetical protein Csa_006160 [Cucumis sativus]) HSP 1 Score: 100.9 bits (250), Expect = 4.6e-18 Identity = 49/60 (81.67%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of Cmc05g0128341 vs. ExPASy Swiss-Prot
Match: Q2FDU6 (4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming) OS=Staphylococcus aureus (strain USA300) OX=367830 GN=crtN PE=3 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 3.0e-04 Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = 0
BLAST of Cmc05g0128341 vs. ExPASy Swiss-Prot
Match: Q2FV60 (4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming) OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=crtN PE=3 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 3.0e-04 Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = 0
BLAST of Cmc05g0128341 vs. ExPASy Swiss-Prot
Match: O07855 (4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming) OS=Staphylococcus aureus (strain Newman) OX=426430 GN=crtN PE=1 SV=2) HSP 1 Score: 45.4 bits (106), Expect = 3.0e-04 Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = 0
BLAST of Cmc05g0128341 vs. ExPASy Swiss-Prot
Match: Q99R76 (4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming) OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=crtN PE=3 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 3.0e-04 Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = 0
BLAST of Cmc05g0128341 vs. ExPASy Swiss-Prot
Match: Q7A3E2 (4,4'-diapophytoene desaturase (4,4'-diaponeurosporene-forming) OS=Staphylococcus aureus (strain N315) OX=158879 GN=crtN PE=1 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 3.0e-04 Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = 0
BLAST of Cmc05g0128341 vs. ExPASy TrEMBL
Match: A0A5A7U4B4 (Mycolic acid cyclopropane synthase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold560G00260 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 8.0e-24 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of Cmc05g0128341 vs. ExPASy TrEMBL
Match: A0A5D3B982 (Cyclopropane-fatty-acyl-phospholipid synthase isoform 5 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold726G00140 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 8.0e-24 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of Cmc05g0128341 vs. ExPASy TrEMBL
Match: A0A5A7U8M1 (Mycolic acid cyclopropane synthase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold560G00430 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 8.0e-24 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0
BLAST of Cmc05g0128341 vs. ExPASy TrEMBL
Match: A0A0A0LKK7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G172490 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 2.2e-18 Identity = 49/60 (81.67%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of Cmc05g0128341 vs. ExPASy TrEMBL
Match: A0A0A0LNM4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G172460 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 2.2e-18 Identity = 49/60 (81.67%), Postives = 55/60 (91.67%), Query Frame = 0
BLAST of Cmc05g0128341 vs. TAIR 10
Match: AT3G23530.1 (Cyclopropane-fatty-acyl-phospholipid synthase ) HSP 1 Score: 73.6 bits (179), Expect = 7.4e-14 Identity = 42/61 (68.85%), Postives = 49/61 (80.33%), Query Frame = 0
BLAST of Cmc05g0128341 vs. TAIR 10
Match: AT3G23510.1 (Cyclopropane-fatty-acyl-phospholipid synthase ) HSP 1 Score: 71.6 bits (174), Expect = 2.8e-13 Identity = 46/75 (61.33%), Postives = 55/75 (73.33%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|