Cmc04g0111861 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAAAAACAAAGAGAGATGTTGTGTTCTTCGTATTTGTCTTAACCATTTTGTTTCCTATCGTTAAATCGCAAACTTTCGATAATTTTTGGTTTGTTCAACAATGGCCACCAGCTATTTGTACTTTACAATCAGGGCGATGTGTAGGACGAGGGACTCGATCCTTCACAATCCATGGTTTGTGGCCTCAAAAGGGAGGAAGATCTGTGACTAATTGTAGTGGCAATTCATTTGACTTCACTAAGGTAAATTGGTTTCAAACATCCAAAATATAA ATGGAAAAAACAAAGAGAGATGTTGTGTTCTTCGTATTTGTCTTAACCATTTTGTTTCCTATCGTTAAATCGCAAACTTTCGATAATTTTTGGTTTGTTCAACAATGGCCACCAGCTATTTGTACTTTACAATCAGGGCGATGTGTAGGACGAGGGACTCGATCCTTCACAATCCATGGTTTGTGGCCTCAAAAGGGAGGAAGATCTGTGACTAATTGTAGTGGCAATTCATTTGACTTCACTAAGGTAAATTGGTTTCAAACATCCAAAATATAA ATGGAAAAAACAAAGAGAGATGTTGTGTTCTTCGTATTTGTCTTAACCATTTTGTTTCCTATCGTTAAATCGCAAACTTTCGATAATTTTTGGTTTGTTCAACAATGGCCACCAGCTATTTGTACTTTACAATCAGGGCGATGTGTAGGACGAGGGACTCGATCCTTCACAATCCATGGTTTGTGGCCTCAAAAGGGAGGAAGATCTGTGACTAATTGTAGTGGCAATTCATTTGACTTCACTAAGGTAAATTGGTTTCAAACATCCAAAATATAA MEKTKRDVVFFVFVLTILFPIVKSQTFDNFWFVQQWPPAICTLQSGRCVGRGTRSFTIHGLWPQKGGRSVTNCSGNSFDFTKVNWFQTSKI Homology
BLAST of Cmc04g0111861 vs. NCBI nr
Match: XP_008443402.1 (PREDICTED: ribonuclease MC-like [Cucumis melo]) HSP 1 Score: 179.5 bits (454), Expect = 1.3e-41 Identity = 82/83 (98.80%), Postives = 83/83 (100.00%), Query Frame = 0
BLAST of Cmc04g0111861 vs. NCBI nr
Match: XP_004147499.1 (ribonuclease MC [Cucumis sativus] >KGN59560.1 hypothetical protein Csa_002553 [Cucumis sativus]) HSP 1 Score: 167.5 bits (423), Expect = 5.2e-38 Identity = 77/84 (91.67%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of Cmc04g0111861 vs. NCBI nr
Match: XP_038905534.1 (ribonuclease MC-like [Benincasa hispida]) HSP 1 Score: 156.0 bits (393), Expect = 1.6e-34 Identity = 69/83 (83.13%), Postives = 76/83 (91.57%), Query Frame = 0
BLAST of Cmc04g0111861 vs. NCBI nr
Match: XP_022155091.1 (ribonuclease MC-like [Momordica charantia]) HSP 1 Score: 136.3 bits (342), Expect = 1.3e-28 Identity = 58/89 (65.17%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of Cmc04g0111861 vs. NCBI nr
Match: BAA10891.1 (ribonuclease (RNase LC1) [Luffa aegyptiaca]) HSP 1 Score: 135.2 bits (339), Expect = 2.8e-28 Identity = 59/89 (66.29%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of Cmc04g0111861 vs. ExPASy Swiss-Prot
Match: P23540 (Ribonuclease MC OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 2.1e-18 Identity = 40/64 (62.50%), Postives = 49/64 (76.56%), Query Frame = 0
BLAST of Cmc04g0111861 vs. ExPASy Swiss-Prot
Match: P80196 (Intracellular ribonuclease LX OS=Solanum lycopersicum OX=4081 GN=RNALX PE=1 SV=2) HSP 1 Score: 58.5 bits (140), Expect = 4.4e-08 Identity = 31/81 (38.27%), Postives = 43/81 (53.09%), Query Frame = 0
BLAST of Cmc04g0111861 vs. ExPASy Swiss-Prot
Match: P42815 (Ribonuclease 3 OS=Arabidopsis thaliana OX=3702 GN=RNS3 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.1e-06 Identity = 34/82 (41.46%), Postives = 45/82 (54.88%), Query Frame = 0
BLAST of Cmc04g0111861 vs. ExPASy Swiss-Prot
Match: P42813 (Ribonuclease 1 OS=Arabidopsis thaliana OX=3702 GN=RNS1 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.4e-06 Identity = 32/85 (37.65%), Postives = 43/85 (50.59%), Query Frame = 0
BLAST of Cmc04g0111861 vs. ExPASy Swiss-Prot
Match: P80022 (Extracellular ribonuclease LE OS=Solanum lycopersicum OX=4081 PE=1 SV=2) HSP 1 Score: 51.2 bits (121), Expect = 7.1e-06 Identity = 24/58 (41.38%), Postives = 31/58 (53.45%), Query Frame = 0
BLAST of Cmc04g0111861 vs. ExPASy TrEMBL
Match: A0A1S3B8Q3 (Ribonuclease T(2) OS=Cucumis melo OX=3656 GN=LOC103486996 PE=3 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 6.4e-42 Identity = 82/83 (98.80%), Postives = 83/83 (100.00%), Query Frame = 0
BLAST of Cmc04g0111861 vs. ExPASy TrEMBL
Match: A0A0A0LC37 (Ribonuclease T(2) OS=Cucumis sativus OX=3659 GN=Csa_3G825050 PE=3 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 2.5e-38 Identity = 77/84 (91.67%), Postives = 81/84 (96.43%), Query Frame = 0
BLAST of Cmc04g0111861 vs. ExPASy TrEMBL
Match: A0A6J1DQN7 (ribonuclease MC-like OS=Momordica charantia OX=3673 GN=LOC111022224 PE=3 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 6.2e-29 Identity = 58/89 (65.17%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of Cmc04g0111861 vs. ExPASy TrEMBL
Match: Q40115 (Ribonuclease (RNase LC1) OS=Luffa aegyptiaca OX=3670 PE=2 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 1.4e-28 Identity = 59/89 (66.29%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of Cmc04g0111861 vs. ExPASy TrEMBL
Match: A0A6J1CKH7 (Ribonuclease T(2) OS=Momordica charantia OX=3673 GN=LOC111012440 PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 2.4e-28 Identity = 58/85 (68.24%), Postives = 68/85 (80.00%), Query Frame = 0
BLAST of Cmc04g0111861 vs. TAIR 10
Match: AT1G26820.1 (ribonuclease 3 ) HSP 1 Score: 53.9 bits (128), Expect = 7.8e-08 Identity = 34/82 (41.46%), Postives = 45/82 (54.88%), Query Frame = 0
BLAST of Cmc04g0111861 vs. TAIR 10
Match: AT2G02990.1 (ribonuclease 1 ) HSP 1 Score: 53.5 bits (127), Expect = 1.0e-07 Identity = 32/85 (37.65%), Postives = 43/85 (50.59%), Query Frame = 0
BLAST of Cmc04g0111861 vs. TAIR 10
Match: AT1G14220.1 (Ribonuclease T2 family protein ) HSP 1 Score: 49.3 bits (116), Expect = 1.9e-06 Identity = 30/83 (36.14%), Postives = 42/83 (50.60%), Query Frame = 0
BLAST of Cmc04g0111861 vs. TAIR 10
Match: AT1G14210.1 (Ribonuclease T2 family protein ) HSP 1 Score: 46.6 bits (109), Expect = 1.2e-05 Identity = 30/87 (34.48%), Postives = 41/87 (47.13%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|