![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Cmc04g0092551 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAAGAATGATAGATCGATGCGCCTTTGCATTGATTACAGAGAGTTGAATAAGGTGACAGTCAAGAATCGCTATCCATTGCCCAGGATTGATGACTTGTTTGATCAGTTGCAAGGAGCCACTATTTTCTCTAAGATCGATTTACATTCAAGCTATCACCAGTTGAGGATTAGAGACAGTGACATTCCTAAGACTGCTTTTGTCACACCCCGATCTAAGTTTTCCCCTCTAACCTAG ATGAAGAAGAATGATAGATCGATGCGCCTTTGCATTGATTACAGAGAGTTGAATAAGGTGACAGTCAAGAATCGCTATCCATTGCCCAGGATTGATGACTTGTTTGATCAGTTGCAAGGAGCCACTATTTTCTCTAAGATCGATTTACATTCAAGCTATCACCAGTTGAGGATTAGAGACAGTGACATTCCTAAGACTGCTTTTGTCACACCCCGATCTAAGTTTTCCCCTCTAACCTAG ATGAAGAAGAATGATAGATCGATGCGCCTTTGCATTGATTACAGAGAGTTGAATAAGGTGACAGTCAAGAATCGCTATCCATTGCCCAGGATTGATGACTTGTTTGATCAGTTGCAAGGAGCCACTATTTTCTCTAAGATCGATTTACATTCAAGCTATCACCAGTTGAGGATTAGAGACAGTGACATTCCTAAGACTGCTTTTGTCACACCCCGATCTAAGTTTTCCCCTCTAACCTAG MKKNDRSMRLCIDYRELNKVTVKNRYPLPRIDDLFDQLQGATIFSKIDLHSSYHQLRIRDSDIPKTAFVTPRSKFSPLT Homology
BLAST of Cmc04g0092551 vs. NCBI nr
Match: KAA0063198.1 (gag protease polyprotein [Cucumis melo var. makuwa] >TYK23495.1 gag protease polyprotein [Cucumis melo var. makuwa]) HSP 1 Score: 159.1 bits (401), Expect = 1.6e-35 Identity = 77/79 (97.47%), Postives = 78/79 (98.73%), Query Frame = 0
BLAST of Cmc04g0092551 vs. NCBI nr
Match: KAA0061127.1 (pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 132.9 bits (333), Expect = 1.2e-27 Identity = 63/68 (92.65%), Postives = 65/68 (95.59%), Query Frame = 0
BLAST of Cmc04g0092551 vs. NCBI nr
Match: TYK03797.1 (pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 132.9 bits (333), Expect = 1.2e-27 Identity = 63/68 (92.65%), Postives = 65/68 (95.59%), Query Frame = 0
BLAST of Cmc04g0092551 vs. NCBI nr
Match: KAA0049632.1 (DNA/RNA polymerases superfamily protein [Cucumis melo var. makuwa] >TYK15992.1 DNA/RNA polymerases superfamily protein [Cucumis melo var. makuwa]) HSP 1 Score: 131.3 bits (329), Expect = 3.6e-27 Identity = 63/68 (92.65%), Postives = 64/68 (94.12%), Query Frame = 0
BLAST of Cmc04g0092551 vs. NCBI nr
Match: TYK09586.1 (pol protein [Cucumis melo var. makuwa]) HSP 1 Score: 131.0 bits (328), Expect = 4.7e-27 Identity = 63/68 (92.65%), Postives = 65/68 (95.59%), Query Frame = 0
BLAST of Cmc04g0092551 vs. ExPASy Swiss-Prot
Match: P31843 (RNA-directed DNA polymerase homolog OS=Oenothera berteroana OX=3950 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 9.1e-18 Identity = 41/69 (59.42%), Postives = 51/69 (73.91%), Query Frame = 0
BLAST of Cmc04g0092551 vs. ExPASy Swiss-Prot
Match: Q99315 (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3) HSP 1 Score: 87.4 bits (215), Expect = 7.7e-17 Identity = 38/73 (52.05%), Postives = 51/73 (69.86%), Query Frame = 0
BLAST of Cmc04g0092551 vs. ExPASy Swiss-Prot
Match: Q7LHG5 (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2) HSP 1 Score: 87.4 bits (215), Expect = 7.7e-17 Identity = 38/73 (52.05%), Postives = 51/73 (69.86%), Query Frame = 0
BLAST of Cmc04g0092551 vs. ExPASy Swiss-Prot
Match: Q9UR07 (Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-11 PE=3 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.3e-13 Identity = 35/76 (46.05%), Postives = 50/76 (65.79%), Query Frame = 0
BLAST of Cmc04g0092551 vs. ExPASy Swiss-Prot
Match: P0CT41 (Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-12 PE=3 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.3e-13 Identity = 35/76 (46.05%), Postives = 50/76 (65.79%), Query Frame = 0
BLAST of Cmc04g0092551 vs. ExPASy TrEMBL
Match: A0A5A7V6F2 (Gag protease polyprotein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold2774G00120 PE=4 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 7.7e-36 Identity = 77/79 (97.47%), Postives = 78/79 (98.73%), Query Frame = 0
BLAST of Cmc04g0092551 vs. ExPASy TrEMBL
Match: A0A5A7V2M6 (Pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold348G00430 PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 5.9e-28 Identity = 63/68 (92.65%), Postives = 65/68 (95.59%), Query Frame = 0
BLAST of Cmc04g0092551 vs. ExPASy TrEMBL
Match: A0A5D3BWB9 (Pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold863G001850 PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 5.9e-28 Identity = 63/68 (92.65%), Postives = 65/68 (95.59%), Query Frame = 0
BLAST of Cmc04g0092551 vs. ExPASy TrEMBL
Match: A0A5A7U1I4 (DNA/RNA polymerases superfamily protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold94G001210 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 1.7e-27 Identity = 63/68 (92.65%), Postives = 64/68 (94.12%), Query Frame = 0
BLAST of Cmc04g0092551 vs. ExPASy TrEMBL
Match: A0A5D3CGU1 (Pol protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold458G00120 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 2.3e-27 Identity = 63/68 (92.65%), Postives = 65/68 (95.59%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|