![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Cmc03g0072671 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTTGGTAGCTCATTATGATTTAGAGCTTCATCAAATGGATGAGAAAACTGCCTTTCTAAATGGAAATTTAGACGAAGAAGTGTTCATGGATCAACCAGAAGATTTTATGATTGAAGTAAAGGAACATATGGTGTGTAAATTAAAGAGGTTAATATATGGACTTAAACAAGCTTCCAGACAGTGGTATCTTAAGTTTAATGATACCATCACATCTTTTAGTTTTATAGAAAACATCGTTGATCGATGTATATACCTAAAGATCAGTGGGAGTAAGTTTATAATTCTTGTTCTATATGTTGATGACATCTTGCTTGCTACAAATGACTTTGGTTTATTATGTCAAACGTCAAACCAAAGAATTTCTTTCTAA ATGGCTTTGGTAGCTCATTATGATTTAGAGCTTCATCAAATGGATGAGAAAACTGCCTTTCTAAATGGAAATTTAGACGAAGAAGTGTTCATGGATCAACCAGAAGATTTTATGATTGAAGTAAAGGAACATATGGTGTGTAAATTAAAGAGGTTAATATATGGACTTAAACAAGCTTCCAGACAGTGGTATCTTAAGTTTAATGATACCATCACATCTTTTAGTTTTATAGAAAACATCGTTGATCGATGTATATACCTAAAGATCAGTGGGAGTAAGTTTATAATTCTTGTTCTATATGTTGATGACATCTTGCTTGCTACAAATGACTTTGGTTTATTATGTCAAACGTCAAACCAAAGAATTTCTTTCTAA ATGGCTTTGGTAGCTCATTATGATTTAGAGCTTCATCAAATGGATGAGAAAACTGCCTTTCTAAATGGAAATTTAGACGAAGAAGTGTTCATGGATCAACCAGAAGATTTTATGATTGAAGTAAAGGAACATATGGTGTGTAAATTAAAGAGGTTAATATATGGACTTAAACAAGCTTCCAGACAGTGGTATCTTAAGTTTAATGATACCATCACATCTTTTAGTTTTATAGAAAACATCGTTGATCGATGTATATACCTAAAGATCAGTGGGAGTAAGTTTATAATTCTTGTTCTATATGTTGATGACATCTTGCTTGCTACAAATGACTTTGGTTTATTATGTCAAACGTCAAACCAAAGAATTTCTTTCTAA MALVAHYDLELHQMDEKTAFLNGNLDEEVFMDQPEDFMIEVKEHMVCKLKRLIYGLKQASRQWYLKFNDTITSFSFIENIVDRCIYLKISGSKFIILVLYVDDILLATNDFGLLCQTSNQRISF Homology
BLAST of Cmc03g0072671 vs. NCBI nr
Match: KAA0052755.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 220.3 bits (560), Expect = 9.2e-54 Identity = 110/117 (94.02%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc03g0072671 vs. NCBI nr
Match: TYK04201.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 220.3 bits (560), Expect = 9.2e-54 Identity = 110/117 (94.02%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc03g0072671 vs. NCBI nr
Match: TYK00088.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 216.9 bits (551), Expect = 1.0e-52 Identity = 107/117 (91.45%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc03g0072671 vs. NCBI nr
Match: KAA0033349.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 211.5 bits (537), Expect = 4.3e-51 Identity = 107/117 (91.45%), Postives = 109/117 (93.16%), Query Frame = 0
BLAST of Cmc03g0072671 vs. NCBI nr
Match: RYE20331.1 (hypothetical protein EOP45_11235, partial [Sphingobacteriaceae bacterium]) HSP 1 Score: 208.4 bits (529), Expect = 3.6e-50 Identity = 103/117 (88.03%), Postives = 109/117 (93.16%), Query Frame = 0
BLAST of Cmc03g0072671 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 9.0e-28 Identity = 59/117 (50.43%), Postives = 87/117 (74.36%), Query Frame = 0
BLAST of Cmc03g0072671 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 100.5 bits (249), Expect = 1.4e-20 Identity = 52/112 (46.43%), Postives = 74/112 (66.07%), Query Frame = 0
BLAST of Cmc03g0072671 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 2.1e-16 Identity = 39/107 (36.45%), Postives = 67/107 (62.62%), Query Frame = 0
BLAST of Cmc03g0072671 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.7e-16 Identity = 42/107 (39.25%), Postives = 65/107 (60.75%), Query Frame = 0
BLAST of Cmc03g0072671 vs. ExPASy Swiss-Prot
Match: P25600 (Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY5A PE=5 SV=2) HSP 1 Score: 59.7 bits (143), Expect = 2.7e-08 Identity = 33/94 (35.11%), Postives = 51/94 (54.26%), Query Frame = 0
BLAST of Cmc03g0072671 vs. ExPASy TrEMBL
Match: A0A5A7UG95 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold43055G00040 PE=4 SV=1) HSP 1 Score: 220.3 bits (560), Expect = 4.4e-54 Identity = 110/117 (94.02%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc03g0072671 vs. ExPASy TrEMBL
Match: A0A5D3BWW5 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1856G00300 PE=4 SV=1) HSP 1 Score: 220.3 bits (560), Expect = 4.4e-54 Identity = 110/117 (94.02%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc03g0072671 vs. ExPASy TrEMBL
Match: A0A5D3BLU0 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold596G00400 PE=4 SV=1) HSP 1 Score: 216.9 bits (551), Expect = 4.9e-53 Identity = 107/117 (91.45%), Postives = 111/117 (94.87%), Query Frame = 0
BLAST of Cmc03g0072671 vs. ExPASy TrEMBL
Match: A0A5A7SVZ5 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold845G001720 PE=4 SV=1) HSP 1 Score: 211.5 bits (537), Expect = 2.1e-51 Identity = 107/117 (91.45%), Postives = 109/117 (93.16%), Query Frame = 0
BLAST of Cmc03g0072671 vs. ExPASy TrEMBL
Match: A0A4V1T029 (Reverse transcriptase Ty1/copia-type domain-containing protein (Fragment) OS=Sphingobacteriaceae bacterium OX=2021370 GN=EOP45_11235 PE=4 SV=1) HSP 1 Score: 208.4 bits (529), Expect = 1.7e-50 Identity = 103/117 (88.03%), Postives = 109/117 (93.16%), Query Frame = 0
BLAST of Cmc03g0072671 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 104.0 bits (258), Expect = 8.9e-23 Identity = 51/124 (41.13%), Postives = 82/124 (66.13%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|