Cmc03g0070381 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGAAGGTCATGTGATTGAAAGATTTATTGGAATCATCCATGTTAATAACACAAGTGCCCTATCACTTAAGAAAGTTATTGATGGTTTTTTCTCTCAACATGGGTTAAGTATTGCTAATTTGCGAGGACAAGGATATGATGAAGCAAGTAATATGCAAGGTGAGCTTCATGGCTTGAAAGCACTTATTTTGAAAGAAAATGAATGTGCTTTTTACATTCATTGTTTTCCTCATCAACTTCAATTACTTGTCTCAAGTCGTACAATGCAATGA ATGGATGAAGGTCATGTGATTGAAAGATTTATTGGAATCATCCATGTTAATAACACAAGTGCCCTATCACTTAAGAAAGTTATTGATGGTTTTTTCTCTCAACATGGGTTAAGTATTGCTAATTTGCGAGGACAAGGATATGATGAAGCAAGTAATATGCAAGGTGAGCTTCATGGCTTGAAAGCACTTATTTTGAAAGAAAATGAATGTGCTTTTTACATTCATTGTTTTCCTCATCAACTTCAATTACTTGTCTCAAGTCGTACAATGCAATGA ATGGATGAAGGTCATGTGATTGAAAGATTTATTGGAATCATCCATGTTAATAACACAAGTGCCCTATCACTTAAGAAAGTTATTGATGGTTTTTTCTCTCAACATGGGTTAAGTATTGCTAATTTGCGAGGACAAGGATATGATGAAGCAAGTAATATGCAAGGTGAGCTTCATGGCTTGAAAGCACTTATTTTGAAAGAAAATGAATGTGCTTTTTACATTCATTGTTTTCCTCATCAACTTCAATTACTTGTCTCAAGTCGTACAATGCAATGA MDEGHVIERFIGIIHVNNTSALSLKKVIDGFFSQHGLSIANLRGQGYDEASNMQGELHGLKALILKENECAFYIHCFPHQLQLLVSSRTMQ Homology
BLAST of Cmc03g0070381 vs. NCBI nr
Match: XP_011658426.2 (zinc finger MYM-type protein 1 [Cucumis sativus]) HSP 1 Score: 133.7 bits (335), Expect = 8.3e-28 Identity = 64/83 (77.11%), Postives = 72/83 (86.75%), Query Frame = 0
BLAST of Cmc03g0070381 vs. NCBI nr
Match: XP_024178694.1 (zinc finger MYM-type protein 1-like [Rosa chinensis]) HSP 1 Score: 130.6 bits (327), Expect = 7.0e-27 Identity = 58/83 (69.88%), Postives = 73/83 (87.95%), Query Frame = 0
BLAST of Cmc03g0070381 vs. NCBI nr
Match: XP_028964695.1 (uncharacterized protein LOC103444377 [Malus domestica]) HSP 1 Score: 130.2 bits (326), Expect = 9.2e-27 Identity = 61/83 (73.49%), Postives = 70/83 (84.34%), Query Frame = 0
BLAST of Cmc03g0070381 vs. NCBI nr
Match: PSS03138.1 (Zinc finger MYM-type protein [Actinidia chinensis var. chinensis]) HSP 1 Score: 129.4 bits (324), Expect = 1.6e-26 Identity = 59/81 (72.84%), Postives = 70/81 (86.42%), Query Frame = 0
BLAST of Cmc03g0070381 vs. NCBI nr
Match: XP_024197949.1 (zinc finger MYM-type protein 1-like [Rosa chinensis]) HSP 1 Score: 129.4 bits (324), Expect = 1.6e-26 Identity = 61/82 (74.39%), Postives = 70/82 (85.37%), Query Frame = 0
BLAST of Cmc03g0070381 vs. ExPASy Swiss-Prot
Match: Q5SVZ6 (Zinc finger MYM-type protein 1 OS=Homo sapiens OX=9606 GN=ZMYM1 PE=1 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.1e-06 Identity = 24/78 (30.77%), Postives = 40/78 (51.28%), Query Frame = 0
BLAST of Cmc03g0070381 vs. ExPASy TrEMBL
Match: A0A2R6Q784 (Zinc finger MYM-type protein OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc21521 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 7.6e-27 Identity = 59/81 (72.84%), Postives = 70/81 (86.42%), Query Frame = 0
BLAST of Cmc03g0070381 vs. ExPASy TrEMBL
Match: A0A2P5BWS1 (DUF4371 domain-containing protein (Fragment) OS=Trema orientale OX=63057 GN=TorRG33x02_305960 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 7.6e-27 Identity = 60/82 (73.17%), Postives = 69/82 (84.15%), Query Frame = 0
BLAST of Cmc03g0070381 vs. ExPASy TrEMBL
Match: A0A7J0F9G5 (Dihydroxyacetone kinase OS=Actinidia rufa OX=165716 GN=Acr_10g0007270 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 9.9e-27 Identity = 60/81 (74.07%), Postives = 70/81 (86.42%), Query Frame = 0
BLAST of Cmc03g0070381 vs. ExPASy TrEMBL
Match: A0A2P6SNT9 (Putative transcription factor and/or regulators TTF-type(Zn) family OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr1g0380371 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 2.9e-26 Identity = 60/82 (73.17%), Postives = 70/82 (85.37%), Query Frame = 0
BLAST of Cmc03g0070381 vs. ExPASy TrEMBL
Match: A0A6P5RJS3 (zinc finger MYM-type protein 1-like OS=Prunus avium OX=42229 GN=LOC110745304 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 3.8e-26 Identity = 59/85 (69.41%), Postives = 73/85 (85.88%), Query Frame = 0
BLAST of Cmc03g0070381 vs. TAIR 10
Match: AT1G19260.1 (TTF-type zinc finger protein with HAT dimerisation domain ) HSP 1 Score: 114.8 bits (286), Expect = 3.7e-26 Identity = 53/82 (64.63%), Postives = 67/82 (81.71%), Query Frame = 0
BLAST of Cmc03g0070381 vs. TAIR 10
Match: AT3G29763.1 (General transcription factor 2-related zinc finger protein ) HSP 1 Score: 113.6 bits (283), Expect = 8.3e-26 Identity = 52/82 (63.41%), Postives = 67/82 (81.71%), Query Frame = 0
BLAST of Cmc03g0070381 vs. TAIR 10
Match: AT3G29765.1 (General transcription factor 2-related zinc finger protein ) HSP 1 Score: 113.6 bits (283), Expect = 8.3e-26 Identity = 52/82 (63.41%), Postives = 67/82 (81.71%), Query Frame = 0
BLAST of Cmc03g0070381 vs. TAIR 10
Match: AT1G41920.1 (General transcription factor 2-related zinc finger protein ) HSP 1 Score: 107.5 bits (267), Expect = 5.9e-24 Identity = 51/82 (62.20%), Postives = 64/82 (78.05%), Query Frame = 0
BLAST of Cmc03g0070381 vs. TAIR 10
Match: AT2G06541.1 (TTF-type zinc finger protein with HAT dimerisation domain ) HSP 1 Score: 104.8 bits (260), Expect = 3.8e-23 Identity = 50/80 (62.50%), Postives = 61/80 (76.25%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|