Cmc03g0066331 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTAATTTTTAGAACAAACATGGAGTTGATAATTGATATTAAGTTGTTTCTCTCATCACACTTTGAAATGATAGACCTAAGAGAAGCAGACGTAATCTTTGGTGTTAAAATCAGGAAAAACAAAACCAGTTTGTCCCTGTGTCAATCTCACTACGTGGAGAAAATACTAAAGAAATTTGATTCCTTTGATGTTTCTCCAGTAAGAACTCCCTTTGACGCTAGTAAACATCTTAAGAAGAATGAAGGAGATAGTGTGTCTCAACCTGAATATGCAAAGATCATAGGTAGTGTGATGTATCTAATGAATTATACTAGACTTGATATTGCATATGTTGTCAGTAGATTGAGTAGATATACACATAATCCTGATAGATACCACTGGAATGCTTTACGCCATTTATTGAGATATGTTAAAGGATGA ATGTTAATTTTTAGAACAAACATGGAGTTGATAATTGATATTAAGTTGTTTCTCTCATCACACTTTGAAATGATAGACCTAAGAGAAGCAGACGTAATCTTTGGTGTTAAAATCAGGAAAAACAAAACCAGTTTGTCCCTGTGTCAATCTCACTACGTGGAGAAAATACTAAAGAAATTTGATTCCTTTGATGTTTCTCCAGTAAGAACTCCCTTTGACGCTAGTAAACATCTTAAGAAGAATGAAGGAGATAGTGTGTCTCAACCTGAATATGCAAAGATCATAGGTAGTGTGATGTATCTAATGAATTATACTAGACTTGATATTGCATATGTTGTCAGTAGATTGAGTAGATATACACATAATCCTGATAGATACCACTGGAATGCTTTACGCCATTTATTGAGATATGTTAAAGGATGA ATGTTAATTTTTAGAACAAACATGGAGTTGATAATTGATATTAAGTTGTTTCTCTCATCACACTTTGAAATGATAGACCTAAGAGAAGCAGACGTAATCTTTGGTGTTAAAATCAGGAAAAACAAAACCAGTTTGTCCCTGTGTCAATCTCACTACGTGGAGAAAATACTAAAGAAATTTGATTCCTTTGATGTTTCTCCAGTAAGAACTCCCTTTGACGCTAGTAAACATCTTAAGAAGAATGAAGGAGATAGTGTGTCTCAACCTGAATATGCAAAGATCATAGGTAGTGTGATGTATCTAATGAATTATACTAGACTTGATATTGCATATGTTGTCAGTAGATTGAGTAGATATACACATAATCCTGATAGATACCACTGGAATGCTTTACGCCATTTATTGAGATATGTTAAAGGATGA MLIFRTNMELIIDIKLFLSSHFEMIDLREADVIFGVKIRKNKTSLSLCQSHYVEKILKKFDSFDVSPVRTPFDASKHLKKNEGDSVSQPEYAKIIGSVMYLMNYTRLDIAYVVSRLSRYTHNPDRYHWNALRHLLRYVKG Homology
BLAST of Cmc03g0066331 vs. NCBI nr
Match: TYK06518.1 (ty1-copia retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 253.8 bits (647), Expect = 8.4e-64 Identity = 127/140 (90.71%), Postives = 131/140 (93.57%), Query Frame = 0
BLAST of Cmc03g0066331 vs. NCBI nr
Match: KAA0049695.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa] >TYK12177.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 238.8 bits (608), Expect = 2.8e-59 Identity = 118/133 (88.72%), Postives = 122/133 (91.73%), Query Frame = 0
BLAST of Cmc03g0066331 vs. NCBI nr
Match: KAA0045258.1 (ty1-copia retrotransposon protein [Cucumis melo var. makuwa] >TYK19282.1 ty1-copia retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 223.4 bits (568), Expect = 1.2e-54 Identity = 110/132 (83.33%), Postives = 118/132 (89.39%), Query Frame = 0
BLAST of Cmc03g0066331 vs. NCBI nr
Match: TYK04656.1 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cucumis melo var. makuwa]) HSP 1 Score: 223.0 bits (567), Expect = 1.6e-54 Identity = 109/117 (93.16%), Postives = 112/117 (95.73%), Query Frame = 0
BLAST of Cmc03g0066331 vs. NCBI nr
Match: KAA0035900.1 (ty1-copia retrotransposon protein [Cucumis melo var. makuwa] >TYK19055.1 ty1-copia retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 221.9 bits (564), Expect = 3.6e-54 Identity = 109/117 (93.16%), Postives = 112/117 (95.73%), Query Frame = 0
BLAST of Cmc03g0066331 vs. ExPASy Swiss-Prot
Match: P10978 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 3.3e-18 Identity = 56/149 (37.58%), Postives = 85/149 (57.05%), Query Frame = 0
BLAST of Cmc03g0066331 vs. ExPASy Swiss-Prot
Match: Q9ZT94 (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 7.5e-15 Identity = 44/124 (35.48%), Postives = 66/124 (53.23%), Query Frame = 0
BLAST of Cmc03g0066331 vs. ExPASy Swiss-Prot
Match: Q94HW2 (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.3e-14 Identity = 45/124 (36.29%), Postives = 66/124 (53.23%), Query Frame = 0
BLAST of Cmc03g0066331 vs. ExPASy Swiss-Prot
Match: P04146 (Copia protein OS=Drosophila melanogaster OX=7227 GN=GIP PE=1 SV=3) HSP 1 Score: 75.5 bits (184), Expect = 5.4e-13 Identity = 45/140 (32.14%), Postives = 72/140 (51.43%), Query Frame = 0
BLAST of Cmc03g0066331 vs. ExPASy Swiss-Prot
Match: P92519 (Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana OX=3702 GN=AtMg00810 PE=4 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 6.6e-11 Identity = 39/123 (31.71%), Postives = 62/123 (50.41%), Query Frame = 0
BLAST of Cmc03g0066331 vs. ExPASy TrEMBL
Match: A0A5D3C5T2 (Ty1-copia retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold70G00500 PE=4 SV=1) HSP 1 Score: 253.8 bits (647), Expect = 4.1e-64 Identity = 127/140 (90.71%), Postives = 131/140 (93.57%), Query Frame = 0
BLAST of Cmc03g0066331 vs. ExPASy TrEMBL
Match: A0A5A7U7W6 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold106G001180 PE=4 SV=1) HSP 1 Score: 238.8 bits (608), Expect = 1.4e-59 Identity = 118/133 (88.72%), Postives = 122/133 (91.73%), Query Frame = 0
BLAST of Cmc03g0066331 vs. ExPASy TrEMBL
Match: A0A5A7TQW7 (Ty1-copia retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1493G00950 PE=4 SV=1) HSP 1 Score: 223.4 bits (568), Expect = 5.9e-55 Identity = 110/132 (83.33%), Postives = 118/132 (89.39%), Query Frame = 0
BLAST of Cmc03g0066331 vs. ExPASy TrEMBL
Match: A0A5D3C2K6 (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1133G00090 PE=4 SV=1) HSP 1 Score: 223.0 bits (567), Expect = 7.7e-55 Identity = 109/117 (93.16%), Postives = 112/117 (95.73%), Query Frame = 0
BLAST of Cmc03g0066331 vs. ExPASy TrEMBL
Match: A0A5D3D697 (Ty1-copia retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold529G00120 PE=4 SV=1) HSP 1 Score: 221.9 bits (564), Expect = 1.7e-54 Identity = 109/117 (93.16%), Postives = 112/117 (95.73%), Query Frame = 0
BLAST of Cmc03g0066331 vs. TAIR 10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8 ) HSP 1 Score: 70.1 bits (170), Expect = 1.6e-12 Identity = 42/141 (29.79%), Postives = 72/141 (51.06%), Query Frame = 0
BLAST of Cmc03g0066331 vs. TAIR 10
Match: ATMG00810.1 (DNA/RNA polymerases superfamily protein ) HSP 1 Score: 68.6 bits (166), Expect = 4.7e-12 Identity = 39/123 (31.71%), Postives = 62/123 (50.41%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|