Cmc02g0054411 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAGTTGCGGGTGTATTGGGCGCTACTCTGCGATGCGTTATTCTTGGTGCTATCGTAGAAAATACCTTATTTGAGGATGAGGATGGTGTAAATACATTCCATGCTTTTAACCTAACTCAAGCTGAAGAAACTTATTCAATGGTCACTGCTAATCGCTTTTGGTCCCAAATCTTTGGGGTTGCTTTTTTCCAATAG ATGGGAGTTGCGGGTGTATTGGGCGCTACTCTGCGATGCGTTATTCTTGGTGCTATCGTAGAAAATACCTTATTTGAGGATGAGGATGGTGTAAATACATTCCATGCTTTTAACCTAACTCAAGCTGAAGAAACTTATTCAATGGTCACTGCTAATCGCTTTTGGTCCCAAATCTTTGGGGTTGCTTTTTTCCAATAG ATGGGAGTTGCGGGTGTATTGGGCGCTACTCTGCGATGCGTTATTCTTGGTGCTATCGTAGAAAATACCTTATTTGAGGATGAGGATGGTGTAAATACATTCCATGCTTTTAACCTAACTCAAGCTGAAGAAACTTATTCAATGGTCACTGCTAATCGCTTTTGGTCCCAAATCTTTGGGGTTGCTTTTTTCCAATAG MGVAGVLGATLRCVILGAIVENTLFEDEDGVNTFHAFNLTQAEETYSMVTANRFWSQIFGVAFFQ Homology
BLAST of Cmc02g0054411 vs. NCBI nr
Match: KAA0032899.1 (photosystem II CP43 reaction center protein-like [Cucumis melo var. makuwa]) HSP 1 Score: 109.8 bits (273), Expect = 9.1e-21 Identity = 55/63 (87.30%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of Cmc02g0054411 vs. NCBI nr
Match: BAD17354.1 (rice chloroplast PSII D2 protein [Oryza sativa Japonica Group]) HSP 1 Score: 109.4 bits (272), Expect = 1.2e-20 Identity = 55/63 (87.30%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of Cmc02g0054411 vs. NCBI nr
Match: PVH47814.1 (hypothetical protein PAHAL_4G159500 [Panicum hallii]) HSP 1 Score: 109.4 bits (272), Expect = 1.2e-20 Identity = 55/65 (84.62%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of Cmc02g0054411 vs. NCBI nr
Match: KAF2944620.1 (hypothetical protein DAI22_02g155901 [Oryza sativa Japonica Group]) HSP 1 Score: 109.4 bits (272), Expect = 1.2e-20 Identity = 55/63 (87.30%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of Cmc02g0054411 vs. NCBI nr
Match: KRH62235.1 (hypothetical protein GLYMA_04G095000v4 [Glycine max]) HSP 1 Score: 109.0 bits (271), Expect = 1.6e-20 Identity = 55/63 (87.30%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of Cmc02g0054411 vs. ExPASy Swiss-Prot
Match: Q4FFP4 (Photosystem II D2 protein OS=Acorus americanus OX=263995 GN=psbD PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.0e-22 Identity = 54/63 (85.71%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of Cmc02g0054411 vs. ExPASy Swiss-Prot
Match: Q3V539 (Photosystem II D2 protein OS=Acorus calamus OX=4465 GN=psbD PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.0e-22 Identity = 54/63 (85.71%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of Cmc02g0054411 vs. ExPASy Swiss-Prot
Match: A4QJB0 (Photosystem II D2 protein OS=Aethionema cordifolium OX=434059 GN=psbD PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.0e-22 Identity = 54/63 (85.71%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of Cmc02g0054411 vs. ExPASy Swiss-Prot
Match: A4QJJ4 (Photosystem II D2 protein OS=Aethionema grandiflorum OX=72657 GN=psbD PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.0e-22 Identity = 54/63 (85.71%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of Cmc02g0054411 vs. ExPASy Swiss-Prot
Match: A1E9Z3 (Photosystem II D2 protein OS=Agrostis stolonifera OX=63632 GN=psbD PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.0e-22 Identity = 54/63 (85.71%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of Cmc02g0054411 vs. ExPASy TrEMBL
Match: A0A287Q826 (Uncharacterized protein OS=Hordeum vulgare subsp. vulgare OX=112509 PE=3 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 2.0e-21 Identity = 56/65 (86.15%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Cmc02g0054411 vs. ExPASy TrEMBL
Match: A0A5A7SUQ3 (Photosystem II D2 protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold81G001010 PE=3 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 4.4e-21 Identity = 55/63 (87.30%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of Cmc02g0054411 vs. ExPASy TrEMBL
Match: A0A2T8JD15 (Uncharacterized protein OS=Panicum hallii OX=206008 GN=PAHAL_4G159500 PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 5.8e-21 Identity = 55/65 (84.62%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of Cmc02g0054411 vs. ExPASy TrEMBL
Match: Q6Z1U4 (Photosystem II D2 protein OS=Oryza sativa subsp. japonica OX=39947 GN=OSJNBa0022A24.62 PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 5.8e-21 Identity = 55/63 (87.30%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of Cmc02g0054411 vs. ExPASy TrEMBL
Match: K7KJ53 (Uncharacterized protein OS=Glycine max OX=3847 GN=GLYMA_04G095000 PE=3 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 7.6e-21 Identity = 55/63 (87.30%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of Cmc02g0054411 vs. TAIR 10
Match: ATCG00270.1 (photosystem II reaction center protein D ) HSP 1 Score: 106.7 bits (265), Expect = 7.2e-24 Identity = 54/63 (85.71%), Postives = 54/63 (85.71%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|